Gene/Proteome Database (LMPD)
LMPD ID
LMP001632
Gene ID
Species
Homo sapiens (Human)
Gene Name
protein arginine methyltransferase 8
Gene Symbol
Synonyms
HRMT1L3; HRMT1L4
Chromosome
12
Map Location
12p13.3
Summary
Arginine methylation is a widespread posttranslational modification mediated by arginine methyltransferases, such as PRMT8. Arginine methylation is involved in a number of cellular processes, including DNA repair, RNA transcription, signal transduction, protein compartmentalization, and possibly protein translation (Lee et al., 2005 [PubMed 16051612]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
protein arginine N-methyltransferase 8 isoform 1 | |
---|---|
Refseq ID | NP_062828 |
Protein GI | 74099699 |
UniProt ID | Q59GT2 |
mRNA ID | NM_019854 |
Length | 394 |
RefSeq Status | VALIDATED |
MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR |
protein arginine N-methyltransferase 8 isoform 2 | |
---|---|
Refseq ID | NP_001243465 |
Protein GI | 374858040 |
UniProt ID | Q9NR22 |
mRNA ID | NM_001256536 |
Length | 385 |
RefSeq Status | VALIDATED |
MESLASDGFKLKEVSSVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR |
Gene Information
Entrez Gene ID
Gene Name
protein arginine methyltransferase 8
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008168 | IEA:UniProtKB-KW | F | methyltransferase activity |
GO:0006479 | IEA:InterPro | P | protein methylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protein arginine methyltransferase 8
Protein Entry
ANM8_HUMAN
UniProt ID
Species
Human
Identical and Related Proteins
Unique RefSeq proteins for LMP001632 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
74099699 | RefSeq | NP_062828 | 394 | protein arginine N-methyltransferase 8 isoform 1 |
374858040 | RefSeq | NP_001243465 | 385 | protein arginine N-methyltransferase 8 isoform 2 |
Identical Sequences to LMP001632 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:74099699 | DBBJ | BAJ20655.1 | 394 | protein arginine methyltransferase 8, partial [synthetic construct] |
GI:74099699 | GenBank | EAW88861.1 | 394 | protein arginine methyltransferase 8, isoform CRA_a [Homo sapiens] |
GI:74099699 | GenBank | ADC20164.1 | 394 | Sequence 385 from patent US 7638288 |
GI:74099699 | GenBank | AGD01125.1 | 394 | Sequence 385 from patent US 8338124 |
GI:74099699 | GenBank | AHE00795.1 | 394 | Sequence 53752 from patent US 8586006 |
GI:74099699 | SwissProt | Q9NR22.2 | 394 | RecName: Full=Protein arginine N-methyltransferase 8; AltName: Full=Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4 [Homo sapiens] |
Related Sequences to LMP001632 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:74099699 | GenBank | AAH22458.2 | 394 | Protein arginine methyltransferase 8 [Homo sapiens] |
GI:74099699 | GenBank | JAB26493.1 | 394 | protein arginine N-methyltransferase 8 isoform 1 [Callithrix jacchus] |
GI:374858040 | GenBank | AHE00795.1 | 394 | Sequence 53752 from patent US 8586006 |
GI:74099699 | RefSeq | XP_001156280.1 | 394 | PREDICTED: protein arginine N-methyltransferase 8 isoform X1 [Pan troglodytes] |
GI:74099699 | RefSeq | XP_003820393.1 | 394 | PREDICTED: protein arginine N-methyltransferase 8 isoform X1 [Pan paniscus] |
GI:374858040 | RefSeq | XP_004279059.1 | 385 | PREDICTED: protein arginine N-methyltransferase 8 isoform 2 [Orcinus orca] |
GI:374858040 | RefSeq | XP_005334062.1 | 385 | PREDICTED: protein arginine N-methyltransferase 8 [Ictidomys tridecemlineatus] |
GI:374858040 | RefSeq | XP_005957070.1 | 385 | PREDICTED: protein arginine N-methyltransferase 8 isoform X1 [Pantholops hodgsonii] |
GI:74099699 | RefSeq | XP_007965450.1 | 394 | PREDICTED: protein arginine N-methyltransferase 8 [Chlorocebus sabaeus] |
GI:374858040 | RefSeq | XP_009245605.1 | 385 | PREDICTED: protein arginine N-methyltransferase 8 isoform X2 [Pongo abelii] |
GI:74099699 | RefSeq | XP_010357472.1 | 394 | PREDICTED: protein arginine N-methyltransferase 8 isoform X1 [Rhinopithecus roxellana] |
GI:374858040 | RefSeq | XP_010357473.1 | 385 | PREDICTED: protein arginine N-methyltransferase 8 isoform X2 [Rhinopithecus roxellana] |