Gene/Proteome Database (LMPD)

LMPD ID
LMP001752
Gene ID
10800
Species
Homo sapiens (Human)
Gene Name
cysteinyl leukotriene receptor 1
Gene Symbol
CYSLTR1
Synonyms
CYSLT1; CYSLT1R; CYSLTR; HMTMF81
Chromosome
X
Map Location
Xq13.2-q21.1
Summary
This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Orthologs
View orthologs and multiple alignments for CYSLTR1

Proteins

cysteinyl leukotriene receptor 1
Refseq ID NP_001269115
Protein GI 532164733
UniProt ID Q38Q88
mRNA ID NM_001282186
Length 337
RefSeq Status REVIEWED
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
cysteinyl leukotriene receptor 1
Refseq ID NP_001269117
Protein GI 532164737
UniProt ID Q38Q88
mRNA ID NM_001282188
Length 337
RefSeq Status REVIEWED
Protein sequence is identical to GI:532164733 (mRNA isoform)
cysteinyl leukotriene receptor 1
Refseq ID NP_001269116
Protein GI 532164735
UniProt ID Q38Q88
mRNA ID NM_001282187
Length 337
RefSeq Status REVIEWED
Protein sequence is identical to GI:532164733 (mRNA isoform)
cysteinyl leukotriene receptor 1
Refseq ID NP_006630
Protein GI 5729798
UniProt ID Q38Q88
mRNA ID NM_006639
Length 337
RefSeq Status REVIEWED
Protein sequence is identical to GI:532164733 (mRNA isoform)

Gene Information

Entrez Gene ID
10800
Gene Name
cysteinyl leukotriene receptor 1
Gene Symbol
CYSLTR1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 IEA:Ensembl C integral component of plasma membrane
GO:0004974 IEA:Ensembl F leukotriene receptor activity
GO:0006816 IEA:Ensembl P calcium ion transport
GO:0006935 IEA:Ensembl P chemotaxis
GO:0006954 IEA:Ensembl P inflammatory response
GO:0045766 IEA:Ensembl P positive regulation of angiogenesis
GO:0045907 IEA:Ensembl P positive regulation of vasoconstriction

Domain Information

InterPro Annotations

Accession Description
IPR004071 Cysteinyl leukotriene receptor
IPR013310 Cysteinyl leukotriene receptor 1
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
cysteinyl leukotriene receptor 1
Protein Entry
CLTR1_HUMAN
UniProt ID
Q38Q88
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP001752 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
532164733 RefSeq NP_001269115 337 cysteinyl leukotriene receptor 1

Identical Sequences to LMP001752 proteins

Reference Database Accession Length Protein Name
GI:532164733 EMBL CCF76997.1 337 unnamed protein product [Homo sapiens]
GI:532164733 GenBank ACS02898.1 337 Sequence 6 from patent US 7531310
GI:532164733 GenBank AFK97662.1 337 Sequence 19 from patent US 8158593
GI:532164733 GenBank AHD75673.1 337 Sequence 18056 from patent US 8586006
GI:532164733 RefSeq NP_001269116.1 337 cysteinyl leukotriene receptor 1 [Homo sapiens]
GI:532164733 RefSeq NP_001269117.1 337 cysteinyl leukotriene receptor 1 [Homo sapiens]

Related Sequences to LMP001752 proteins

Reference Database Accession Length Protein Name
GI:532164733 GenBank AAE62737.1 337 Sequence 2 from patent US 6200775
GI:532164733 GenBank AAH35750.1 337 Cysteinyl leukotriene receptor 1 [Homo sapiens]
GI:532164733 GenBank AAO98067.1 337 Sequence 2 from patent US 6506878
GI:532164733 GenBank ABM81873.1 337 cysteinyl leukotriene receptor 1 [synthetic construct]
GI:532164733 GenBank ABW03343.1 337 cysteinyl leukotriene receptor 1, partial [synthetic construct]
GI:532164733 RefSeq XP_004064481.1 337 PREDICTED: cysteinyl leukotriene receptor 1 [Gorilla gorilla gorilla]