Gene/Proteome Database (LMPD)
LMPD ID
LMP001774
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Gene Symbol
Synonyms
Siat7c
Chromosome
3
Map Location
3|3 H4
Proteins
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 | |
---|---|
Refseq ID | NP_035502 |
Protein GI | 10304989 |
UniProt ID | Q544M3 |
mRNA ID | NM_011372 |
Length | 305 |
RefSeq Status | PROVISIONAL |
MACILKRKPVLVVSFIALCILLLAMRLVNDATFPLLLNCFGQPKTKWIPLPYTFRQPLRTHYGYINVRTQEPLQLNCNHCAIVSNSGQMVGQKVGEEIDHASCIWRMNNAPTKGFEEDVGYMTMVRVVSHTSVPLLLKNPDYFFKEASRTIYVIWGPFRNMRKDGNGIVYNMLKKTVDAYPDAQIYVTTEQQMTHCDRVFKDETGKDRVQSGSYLSTGWFTFILAMDACYSIHVYGMINETYCKTEGYRKVPYHYYEQGKDECNEYLLHEHAPYGGHRFITEKKVFAKWAKKHRIVFTHPNWTLS |
Gene Information
Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
GO:0006677 | IEA:Ensembl | P | glycosylceramide metabolic process |
GO:0006486 | IEA:InterPro | P | protein glycosylation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001675 | Glycosyl transferase, family 29 |
UniProt Annotations
Entry Information
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Protein Entry
SIA7C_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP001774 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
10304989 | RefSeq | NP_035502 | 305 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 |
Identical Sequences to LMP001774 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:10304989 | DBBJ | BAC28836.1 | 305 | unnamed protein product [Mus musculus] |
GI:10304989 | GenBank | AAH58387.1 | 305 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 [Mus musculus] |
GI:10304989 | GenBank | AAI31988.1 | 305 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 [Mus musculus] |
GI:10304989 | GenBank | AAI32318.1 | 305 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 [Mus musculus] |
GI:10304989 | GenBank | EDL11908.1 | 305 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 [Mus musculus] |
GI:10304989 | SwissProt | Q9WUV2.2 | 305 | RecName: Full=Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3; AltName: Full=GalNAc alpha-2,6-sialyltransferase III; AltName: Full=ST6GalNAc III; Short=ST6GalNAcIII; AltName: Full=STY; AltName: Full=Sialyltransferase 7C; Short=SIAT7-C [Mus musculus] |
Related Sequences to LMP001774 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:10304989 | GenBank | AAC42086.1 | 305 | alpha 2,6-sialyltransferase [Rattus norvegicus] |
GI:10304989 | PRF | - | 305 | GlcNAc alpha2,6-sialyltransferase [Rattus norvegicus] |
GI:10304989 | RefSeq | NP_061996.1 | 305 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 [Rattus norvegicus] |
GI:10304989 | RefSeq | XP_006501282.1 | 315 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform X1 [Mus musculus] |
GI:10304989 | RefSeq | XP_006501283.1 | 300 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform X2 [Mus musculus] |
GI:10304989 | SwissProt | Q64686.1 | 305 | RecName: Full=Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3; AltName: Full=GalNAc alpha-2,6-sialyltransferase III; AltName: Full=ST6GalNAc III; Short=ST6GalNAcIII; AltName: Full=STY; AltName: Full=Sialyltransferase 7C; Short=SIAT7-C [Rattus norvegicus] |