Gene/Proteome Database (LMPD)
Proteins
acid ceramidase precursor | |
---|---|
Refseq ID | NP_062708 |
Protein GI | 9790019 |
UniProt ID | Q78P93 |
mRNA ID | NM_019734 |
Length | 394 |
RefSeq Status | VALIDATED |
MRGQSLLTWVLAAAVTCAQAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTMCTSIITEDEKGHLLHGRNMDFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKATSFVGYVGMLTGFKPGLFSLSLNERFSINGGYLGILEWMFGRKDAQWVGFITRSVLENTTSYEEAKNTLTKTKIMAPVYFILGGKKSGEGCVITRERKESLDVYELDPKHGRWYVVQTNYDRWKNTLFIDDRRTPAKKCLNHTTQKNLSFATIYDVLSTKPVLNKLTVFTTLMDVTKGQFESHLRDCPDPCIGW | |
sig_peptide: 1..18 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (Q9WV54.1) calculated_mol_wt: 1891 peptide sequence: MRGQSLLTWVLAAAVTCA mat_peptide: 19..141 product: Acid ceramidase subunit alpha experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9WV54.1) calculated_mol_wt: 13797 peptide sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM mat_peptide: 142..394 product: Acid ceramidase subunit beta experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9WV54.1) calculated_mol_wt: 29017 peptide sequence: CTSIITEDEKGHLLHGRNMDFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKATSFVGYVGMLTGFKPGLFSLSLNERFSINGGYLGILEWMFGRKDAQWVGFITRSVLENTTSYEEAKNTLTKTKIMAPVYFILGGKKSGEGCVITRERKESLDVYELDPKHGRWYVVQTNYDRWKNTLFIDDRRTPAKKCLNHTTQKNLSFATIYDVLSTKPVLNKLTVFTTLMDVTKGQFESHLRDCPDPCIGW |
Gene Information
Entrez Gene ID
Gene Name
N-acylsphingosine amidohydrolase 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0005764 | IEA:InterPro | C | lysosome |
GO:0017040 | IDA:MGI | F | ceramidase activity |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
GO:0030324 | IEA:Ensembl | P | lung development |
GO:0010033 | IEA:Ensembl | P | response to organic substance |
Domain Information
UniProt Annotations
Entry Information
Gene Name
N-acylsphingosine amidohydrolase 1
Protein Entry
ASAH1_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP001776 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
9790019 | RefSeq | NP_062708 | 394 | acid ceramidase precursor |
Identical Sequences to LMP001776 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:9790019 | DBBJ | BAC36053.1 | 394 | unnamed protein product [Mus musculus] |
GI:9790019 | DBBJ | BAC36980.1 | 394 | unnamed protein product [Mus musculus] |
GI:9790019 | DBBJ | BAC41166.1 | 394 | unnamed protein product [Mus musculus] |
GI:9790019 | DBBJ | BAE38998.1 | 394 | unnamed protein product [Mus musculus] |
GI:9790019 | DBBJ | BAE30433.1 | 394 | unnamed protein product [Mus musculus] |
GI:9790019 | GenBank | EDL35519.1 | 394 | N-acylsphingosine amidohydrolase 1, isoform CRA_a [Mus musculus] |
Related Sequences to LMP001776 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:9790019 | DBBJ | BAE31879.1 | 394 | unnamed protein product [Mus musculus] |
GI:9790019 | DBBJ | BAE35181.1 | 394 | unnamed protein product [Mus musculus] |
GI:9790019 | DBBJ | BAE31111.1 | 394 | unnamed protein product [Mus musculus] |
GI:9790019 | GenBank | AAH61540.1 | 394 | N-acylsphingosine amidohydrolase (acid ceramidase) 1 [Rattus norvegicus] |
GI:9790019 | RefSeq | NP_445859.2 | 394 | acid ceramidase precursor [Rattus norvegicus] |
GI:9790019 | SwissProt | Q6P7S1.1 | 394 | RecName: Full=Acid ceramidase; Short=AC; Short=ACDase; Short=Acid CDase; AltName: Full=Acylsphingosine deacylase; AltName: Full=N-acylsphingosine amidohydrolase; Flags: Precursor [Rattus norvegicus] |