Gene/Proteome Database (LMPD)

LMPD ID
LMP001783
Gene ID
19082
Species
Mus musculus (Mouse)
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
Prkag1
Synonyms
AA571379; BB036179; Prkaac
Alternate Names
5'-AMP-activated protein kinase subunit gamma-1;,AMPKg; AMPK gamma1; AMPK subunit gamma-1
Chromosome
15
Map Location
15 F1|15 54.73 cM

Proteins

5'-AMP-activated protein kinase subunit gamma-1
Refseq ID NP_058061
Protein GI 124107596
UniProt ID O54950
mRNA ID NM_016781
Length 330
RefSeq Status VALIDATED
MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP

Gene Information

Entrez Gene ID
19082
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
Prkag1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031588 ISS:UniProtKB C AMP-activated protein kinase complex
GO:0005829 TAS:Reactome C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005634 IDA:MGI C nucleus
GO:0043531 ISS:UniProtKB F ADP binding
GO:0016208 ISS:UniProtKB F AMP binding
GO:0004679 TAS:MGI F AMP-activated protein kinase activity
GO:0005524 ISS:UniProtKB F ATP binding
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process
GO:0010628 IEA:Ensembl P positive regulation of gene expression
GO:0051291 IEA:Ensembl P protein heterooligomerization
GO:0050790 IEA:Ensembl P regulation of catalytic activity

KEGG Pathway Links

KEGG Pathway ID Description
mmu04152 AMPK signaling pathway
mmu04068 FoxO signaling pathway
mmu04932 Non-alcoholic fatty liver disease (NAFLD)
mmu04921 Oxytocin signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR000644 CBS domain

UniProt Annotations

Entry Information

Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Protein Entry
AAKG1_MOUSE
UniProt ID
O54950
Species
Mouse

Comments

Comment Type Description
Domain The AMPK pseudosubstrate motif resembles the sequence around sites phosphorylated on target proteins of AMPK, except the presence of a non-phosphorylatable residue in place of Ser. In the absence of AMP this pseudosubstrate sequence may bind to the active site groove on the alpha subunit (PRKAA1 or PRKAA2), preventing phosphorylation by the upstream activating kinase STK11/LKB1 (By similarity). {ECO:0000250}.
Domain The CBS domains mediate binding to AMP, ADP and ATP. 2 sites bind either AMP or ATP, whereas a third site contains a tightly bound AMP that does not exchange. Under physiological conditions AMPK mainly exists in its inactive form in complex with ATP, which is much more abundant than AMP (By similarity). {ECO:0000250}.
Function AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive (By similarity). {ECO:0000250}.
Ptm Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK. {ECO:0000269|PubMed:21460634}.
Similarity Belongs to the 5'-AMP-activated protein kinase gamma subunit family. {ECO:0000305}.
Similarity Contains 4 CBS domains. {ECO:0000255|PROSITE- ProRule:PRU00703}.
Subunit AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). Interacts with FNIP1 and FNIP2 (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001783 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
124107596 RefSeq NP_058061 330 5'-AMP-activated protein kinase subunit gamma-1

Identical Sequences to LMP001783 proteins

Reference Database Accession Length Protein Name
GI:124107596 DBBJ BAE35203.1 330 unnamed protein product [Mus musculus]
GI:124107596 DBBJ BAE23624.1 330 unnamed protein product [Mus musculus]
GI:124107596 GenBank AAH86660.1 330 Protein kinase, AMP-activated, gamma 1 non-catalytic subunit [Mus musculus]
GI:124107596 SwissProt O54950.2 330 RecName: Full=5'-AMP-activated protein kinase subunit gamma-1; Short=AMPK gamma1; Short=AMPK subunit gamma-1; Short=AMPKg [Mus musculus]

Related Sequences to LMP001783 proteins

Reference Database Accession Length Protein Name
GI:124107596 PDB 2V8Q 330 Chain E, Crystal Structure Of The Regulatory Fragment Of Mammalian Ampk In Complexes With Amp
GI:124107596 PDB 2Y8L 330 Chain E, Structure Of The Regulatory Fragment Of Mammalian Ampk In Complex With Two Adp
GI:124107596 PDB 2Y8Q 330 Chain E, Structure Of The Regulatory Fragment Of Mammalian Ampk In Complex With One Adp
GI:124107596 PDB 2YA3 330 Chain E, Structure Of The Regulatory Fragment Of Mammalian Ampk In Complex With Coumarin Adp
GI:124107596 RefSeq NP_037142.1 330 5'-AMP-activated protein kinase subunit gamma-1 [Rattus norvegicus]
GI:124107596 SwissProt P80385.3 330 RecName: Full=5'-AMP-activated protein kinase subunit gamma-1; Short=AMPK gamma1; Short=AMPK subunit gamma-1; Short=AMPKg [Rattus norvegicus]