Gene/Proteome Database (LMPD)
LMPD ID
LMP001783
Gene ID
Species
Mus musculus (Mouse)
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
Synonyms
AA571379; BB036179; Prkaac
Alternate Names
5'-AMP-activated protein kinase subunit gamma-1;,AMPKg; AMPK gamma1; AMPK subunit gamma-1
Chromosome
15
Map Location
15 F1|15 54.73 cM
Proteins
5'-AMP-activated protein kinase subunit gamma-1 | |
---|---|
Refseq ID | NP_058061 |
Protein GI | 124107596 |
UniProt ID | O54950 |
mRNA ID | NM_016781 |
Length | 330 |
RefSeq Status | VALIDATED |
MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP |
Gene Information
Entrez Gene ID
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0031588 | ISS:UniProtKB | C | AMP-activated protein kinase complex |
GO:0005829 | TAS:Reactome | C | cytosol |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0005634 | IDA:MGI | C | nucleus |
GO:0043531 | ISS:UniProtKB | F | ADP binding |
GO:0004679 | TAS:MGI | F | AMP-activated protein kinase activity |
GO:0016208 | ISS:UniProtKB | F | AMP binding |
GO:0005524 | ISS:UniProtKB | F | ATP binding |
GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
GO:0010628 | IEA:Ensembl | P | positive regulation of gene expression |
GO:0051291 | IEA:Ensembl | P | protein heterooligomerization |
GO:0050790 | IEA:Ensembl | P | regulation of catalytic activity |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR000644 | CBS domain |
UniProt Annotations
Entry Information
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Protein Entry
AAKG1_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Domain | The AMPK pseudosubstrate motif resembles the sequence around sites phosphorylated on target proteins of AMPK, except the presence of a non-phosphorylatable residue in place of Ser. In the absence of AMP this pseudosubstrate sequence may bind to the active site groove on the alpha subunit (PRKAA1 or PRKAA2), preventing phosphorylation by the upstream activating kinase STK11/LKB1 (By similarity). {ECO:0000250}. |
Domain | The CBS domains mediate binding to AMP, ADP and ATP. 2 sites bind either AMP or ATP, whereas a third site contains a tightly bound AMP that does not exchange. Under physiological conditions AMPK mainly exists in its inactive form in complex with ATP, which is much more abundant than AMP (By similarity). {ECO:0000250}. |
Function | AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive (By similarity). {ECO:0000250}. |
Ptm | Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK. {ECO:0000269|PubMed:21460634}. |
Similarity | Belongs to the 5'-AMP-activated protein kinase gamma subunit family. {ECO:0000305}. |
Similarity | Contains 4 CBS domains. {ECO:0000255|PROSITE- ProRule:PRU00703}. |
Subunit | AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). Interacts with FNIP1 and FNIP2 (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001783 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
124107596 | RefSeq | NP_058061 | 330 | 5'-AMP-activated protein kinase subunit gamma-1 |
Identical Sequences to LMP001783 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:124107596 | DBBJ | BAE35203.1 | 330 | unnamed protein product [Mus musculus] |
GI:124107596 | DBBJ | BAE23624.1 | 330 | unnamed protein product [Mus musculus] |
GI:124107596 | GenBank | AAH86660.1 | 330 | Protein kinase, AMP-activated, gamma 1 non-catalytic subunit [Mus musculus] |
GI:124107596 | SwissProt | O54950.2 | 330 | RecName: Full=5'-AMP-activated protein kinase subunit gamma-1; Short=AMPK gamma1; Short=AMPK subunit gamma-1; Short=AMPKg [Mus musculus] |
Related Sequences to LMP001783 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:124107596 | PDB | 2V8Q | 330 | Chain E, Crystal Structure Of The Regulatory Fragment Of Mammalian Ampk In Complexes With Amp |
GI:124107596 | PDB | 2Y8L | 330 | Chain E, Structure Of The Regulatory Fragment Of Mammalian Ampk In Complex With Two Adp |
GI:124107596 | PDB | 2Y8Q | 330 | Chain E, Structure Of The Regulatory Fragment Of Mammalian Ampk In Complex With One Adp |
GI:124107596 | PDB | 2YA3 | 330 | Chain E, Structure Of The Regulatory Fragment Of Mammalian Ampk In Complex With Coumarin Adp |
GI:124107596 | RefSeq | NP_037142.1 | 330 | 5'-AMP-activated protein kinase subunit gamma-1 [Rattus norvegicus] |
GI:124107596 | SwissProt | P80385.3 | 330 | RecName: Full=5'-AMP-activated protein kinase subunit gamma-1; Short=AMPK gamma1; Short=AMPK subunit gamma-1; Short=AMPKg [Rattus norvegicus] |