Gene/Proteome Database (LMPD)

LMPD ID
LMP001786
Gene ID
10434
Species
Homo sapiens (Human)
Gene Name
lysophospholipase I
Gene Symbol
LYPLA1
Synonyms
APT-1; APT1; LPL-I; LPL1; hAPT1
Chromosome
8
Map Location
8q11.23
EC Number
3.1.2.-
Summary
This gene encodes a member of the alpha/beta hydrolase superfamily. The encoded protein functions as a homodimer, exhibiting both depalmitoylating as well as lysophospholipase activity, and may be involved in Ras localization and signaling. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 4, 6, and 7. [provided by RefSeq, Jul 2013]
Orthologs
View orthologs and multiple alignments for LYPLA1

Proteins

acyl-protein thioesterase 1 isoform 1
Refseq ID NP_006321
Protein GI 5453722
UniProt ID Q6IAQ1
mRNA ID NM_006330
Length 230
RefSeq Status REVIEWED
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
acyl-protein thioesterase 1 isoform 2
Refseq ID NP_001266285
Protein GI 525342559
UniProt ID O75608
mRNA ID NM_001279356
Length 196
RefSeq Status REVIEWED
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
acyl-protein thioesterase 1 isoform 3
Refseq ID NP_001266286
Protein GI 525342581
UniProt ID O75608
mRNA ID NM_001279357
Length 214
RefSeq Status REVIEWED
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
acyl-protein thioesterase 1 isoform 4
Refseq ID NP_001266287
Protein GI 525342581
UniProt ID O75608
mRNA ID NM_001279358
Length 214
RefSeq Status REVIEWED
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
acyl-protein thioesterase 1 isoform 5
Refseq ID NP_001266288
Protein GI 525342604
UniProt ID O75608
mRNA ID NM_001279359
Length 181
RefSeq Status REVIEWED
MGRSLCRPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
acyl-protein thioesterase 1 isoform 6
Refseq ID NP_001266289
Protein GI 525342604
UniProt ID O75608
mRNA ID NM_001279360
Length 181
RefSeq Status REVIEWED
MGRSLCRPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID

Gene Information

Entrez Gene ID
10434
Gene Name
lysophospholipase I
Gene Symbol
LYPLA1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0070062 IDA:UniProtKB C extracellular vesicular exosome
GO:0005739 IEA:Ensembl C mitochondrion
GO:0004622 TAS:ProtInc F lysophospholipase activity
GO:0008474 IMP:UniProtKB F palmitoyl-(protein) hydrolase activity
GO:0006631 IEA:UniProtKB-KW P fatty acid metabolic process
GO:0042997 IEA:Ensembl P negative regulation of Golgi to plasma membrane protein transport
GO:0046209 TAS:Reactome P nitric oxide metabolic process
GO:0002084 IEA:Ensembl P protein depalmitoylation
GO:0050999 TAS:Reactome P regulation of nitric-oxide synthase activity
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00564 Glycerophospholipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_12508 Metabolism of nitric oxide
REACT_12477 eNOS activation
REACT_12389 eNOS activation and regulation

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR003140 Phospholipase/carboxylesterase/thioesterase

UniProt Annotations

Entry Information

Gene Name
lysophospholipase I
Protein Entry
LYPA1_HUMAN
UniProt ID
Q6IAQ1
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O75608-1; Sequence=Displayed; Name=2; IsoId=O75608-2; Sequence=VSP_009196; Note=No experimental confirmation available.;
Catalytic Activity Palmitoyl-protein + H(2)O = palmitate + protein.
Enzyme Regulation Inhibited by palmostatin-B, leading to impair depalmitoylating of Ras.
Function Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity. {ECO
Sequence Caution Sequence=AAB88180.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the AB hydrolase superfamily. AB hydrolase 2 family.
Subcellular Location Cytoplasm .
Subunit Homodimer.

Identical and Related Proteins

Unique RefSeq proteins for LMP001786 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
5453722 RefSeq NP_006321 230 acyl-protein thioesterase 1 isoform 1
525342559 RefSeq NP_001266285 196 acyl-protein thioesterase 1 isoform 2
525342581 RefSeq NP_001266286 214 acyl-protein thioesterase 1 isoform 3
525342581 RefSeq NP_001266287 214 acyl-protein thioesterase 1 isoform 4
525342604 RefSeq NP_001266288 181 acyl-protein thioesterase 1 isoform 5
525342604 RefSeq NP_001266289 181 acyl-protein thioesterase 1 isoform 6

Identical Sequences to LMP001786 proteins

Reference Database Accession Length Protein Name
GI:5453722 DBBJ BAF82089.1 230 unnamed protein product [Homo sapiens]
GI:5453722 DBBJ BAG36480.1 230 unnamed protein product [Homo sapiens]
GI:525342559 DBBJ BAG60476.1 196 unnamed protein product [Homo sapiens]
GI:525342581 GenBank AAD26994.1 214 lysophospholipase isoform [Homo sapiens]
GI:525342581 GenBank AAD26994.1 214 lysophospholipase isoform [Homo sapiens]
GI:525342581 GenBank EAW86745.1 214 lysophospholipase I, isoform CRA_c [Homo sapiens]
GI:525342581 GenBank EAW86745.1 214 lysophospholipase I, isoform CRA_c [Homo sapiens]
GI:5453722 GenBank ABM82453.1 230 lysophospholipase I [synthetic construct]
GI:5453722 GenBank ABM85643.1 230 lysophospholipase I, partial [synthetic construct]
GI:5453722 GenBank AHD78529.1 230 Sequence 26527 from patent US 8586006
GI:5453722 GenBank AIC55774.1 230 LYPLA1, partial [synthetic construct]
GI:525342581 RefSeq XP_003256012.1 214 PREDICTED: acyl-protein thioesterase 1 isoform 2 [Nomascus leucogenys]
GI:525342581 RefSeq XP_003256012.1 214 PREDICTED: acyl-protein thioesterase 1 isoform 2 [Nomascus leucogenys]
GI:525342604 RefSeq XP_005251184.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X1 [Homo sapiens]
GI:525342604 RefSeq XP_005251184.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X1 [Homo sapiens]

Related Sequences to LMP001786 proteins

Reference Database Accession Length Protein Name
GI:5453722 DBBJ BAG58971.1 263 unnamed protein product [Homo sapiens]
GI:5453722 EMBL CAH90793.1 230 hypothetical protein [Pongo abelii]
GI:525342581 GenBank AAD26993.1 230 lysophospholipase [Homo sapiens]
GI:525342559 GenBank AAD26993.1 230 lysophospholipase [Homo sapiens]
GI:525342581 GenBank AAD26993.1 230 lysophospholipase [Homo sapiens]
GI:525342581 GenBank AAG10063.1 230 acyl-protein thioesterase-1 [Homo sapiens]
GI:525342581 GenBank AAG10063.1 230 acyl-protein thioesterase-1 [Homo sapiens]
GI:525342559 GenBank AAG10063.1 230 acyl-protein thioesterase-1 [Homo sapiens]
GI:525342581 GenBank AAE30797.1 230 Sequence 3 from patent US 5965423
GI:525342559 GenBank AAE30797.1 230 Sequence 3 from patent US 5965423
GI:525342581 GenBank AAE30797.1 230 Sequence 3 from patent US 5965423
GI:5453722 GenBank ABY00364.1 230 Sequence 2 from patent US 7294496
GI:525342559 GenBank AHD78529.1 230 Sequence 26527 from patent US 8586006
GI:525342559 RefSeq NP_006321.1 230 acyl-protein thioesterase 1 isoform 1 [Homo sapiens]
GI:525342581 RefSeq NP_006321.1 230 acyl-protein thioesterase 1 isoform 1 [Homo sapiens]
GI:525342581 RefSeq NP_006321.1 230 acyl-protein thioesterase 1 isoform 1 [Homo sapiens]
GI:5453722 RefSeq NP_001125450.1 230 acyl-protein thioesterase 1 [Pongo abelii]
GI:5453722 RefSeq XP_003256011.1 230 PREDICTED: acyl-protein thioesterase 1 isoform 1 [Nomascus leucogenys]
GI:525342581 RefSeq XP_005563379.1 214 PREDICTED: acyl-protein thioesterase 1 isoform X3 [Macaca fascicularis]
GI:525342581 RefSeq XP_005563379.1 214 PREDICTED: acyl-protein thioesterase 1 isoform X3 [Macaca fascicularis]
GI:525342559 RefSeq XP_005563380.1 196 PREDICTED: acyl-protein thioesterase 1 isoform X4 [Macaca fascicularis]
GI:525342604 RefSeq XP_005563382.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X6 [Macaca fascicularis]
GI:525342604 RefSeq XP_005563382.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X6 [Macaca fascicularis]
GI:525342604 RefSeq XP_007998843.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X4 [Chlorocebus sabaeus]
GI:525342604 RefSeq XP_007998843.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X4 [Chlorocebus sabaeus]
GI:525342604 RefSeq XP_007998844.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X4 [Chlorocebus sabaeus]
GI:525342604 RefSeq XP_007998844.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X4 [Chlorocebus sabaeus]
GI:525342604 RefSeq XP_007998845.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X4 [Chlorocebus sabaeus]
GI:525342604 RefSeq XP_007998845.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X4 [Chlorocebus sabaeus]
GI:525342604 RefSeq XP_009211304.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X3 [Papio anubis]
GI:525342604 RefSeq XP_009211304.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X3 [Papio anubis]
GI:525342581 RefSeq XP_009453674.1 214 PREDICTED: acyl-protein thioesterase 1 isoform X2 [Pan troglodytes]
GI:525342581 RefSeq XP_009453674.1 214 PREDICTED: acyl-protein thioesterase 1 isoform X2 [Pan troglodytes]
GI:525342604 RefSeq XP_009453676.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X4 [Pan troglodytes]
GI:525342604 RefSeq XP_009453676.1 181 PREDICTED: acyl-protein thioesterase 1 isoform X4 [Pan troglodytes]
GI:5453722 SwissProt Q5RBR7.1 230 RecName: Full=Acyl-protein thioesterase 1; Short=APT-1; AltName: Full=Lysophospholipase 1; AltName: Full=Lysophospholipase I; Short=LPL-I; Short=LysoPLA I [Pongo abelii]