Gene/Proteome Database (LMPD)

LMPD ID
LMP001809
Gene ID
55301
Species
Homo sapiens (Human)
Gene Name
oleoyl-ACP hydrolase
Gene Symbol
OLAH
Synonyms
AURA1; SAST; THEDC1
Alternate Names
S-acyl fatty acid synthase thioesterase, medium chain; thioesterase II; thioesterase domain containing 1; augmented in rheumatoid arthritis 1; thioesterase domain-containing protein 1
Chromosome
10
Map Location
10p13
EC Number
3.1.2.14

Proteins

S-acyl fatty acid synthase thioesterase, medium chain isoform 1
Refseq ID NP_060794
Protein GI 8922871
UniProt ID Q9NV23
mRNA ID NM_018324
Length 318
RefSeq Status VALIDATED
MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEETASHHVAKAGLKLRRSSDPPASAYPCAGVSHRRREPPCLAKILGLFWILIFFMHSLRLPGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF
S-acyl fatty acid synthase thioesterase, medium chain isoform 2
Refseq ID NP_001034791
Protein GI 89257335
UniProt ID Q9NV23
mRNA ID NM_001039702
Length 265
RefSeq Status VALIDATED
MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF

Gene Information

Entrez Gene ID
55301
Gene Name
oleoyl-ACP hydrolase
Gene Symbol
OLAH
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016295 IEA:UniProtKB-EC F myristoyl-[acyl-carrier-protein] hydrolase activity
GO:0004320 IEA:UniProtKB-EC F oleoyl-[acyl-carrier-protein] hydrolase activity
GO:0016296 IEA:UniProtKB-EC F palmitoyl-[acyl-carrier-protein] hydrolase activity
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00061 Fatty acid biosynthesis
ko00061 Fatty acid biosynthesis
hsa01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR001031 Thioesterase
IPR012223 Thioesterase type II, NRPS/PKS/S-FAS

UniProt Annotations

Entry Information

Gene Name
oleoyl-ACP hydrolase
Protein Entry
SAST_HUMAN
UniProt ID
Q9NV23
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NV23-1; Sequence=Displayed; Name=2; IsoId=Q9NV23-2; Sequence=VSP_040022;
Catalytic Activity Oleoyl-[acyl-carrier-protein] + H(2)O = [acyl- carrier-protein] + oleate.
Function In fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released fatty acid is usually C16. However, in the mammary glands of non-ruminant mammals, and in the uropygial gland of certain waterfowl there exists a second thioesterase which releases medium-chain length fatty acids (C8 to C2) (By similarity).
Similarity Belongs to the thioesterase family.
Tissue Specificity Isoform 2 is up-regulated in bone marrow- derived mononuclear cells of rheumatoid arthritis patients.

Identical and Related Proteins

Unique RefSeq proteins for LMP001809 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8922871 RefSeq NP_060794 318 S-acyl fatty acid synthase thioesterase, medium chain isoform 1
89257335 RefSeq NP_001034791 265 S-acyl fatty acid synthase thioesterase, medium chain isoform 2

Identical Sequences to LMP001809 proteins

Reference Database Accession Length Protein Name
GI:8922871 DBBJ BAA92007.1 318 unnamed protein product [Homo sapiens]
GI:89257335 EMBL CAE89822.1 265 unnamed protein product [Homo sapiens]
GI:8922871 EMBL CAE89928.1 318 unnamed protein product [Homo sapiens]
GI:89257335 GenBank AAQ52095.1 265 Sequence 14 from patent US 6593099
GI:8922871 GenBank AAQ52096.1 318 Sequence 16 from patent US 6593099
GI:8922871 GenBank EAW86244.1 318 thioesterase domain containing 1, isoform CRA_a [Homo sapiens]
GI:89257335 GenBank EAW86245.1 265 thioesterase domain containing 1, isoform CRA_b [Homo sapiens]
GI:89257335 GenBank ADQ33115.1 265 oleoyl-ACP hydrolase, partial [synthetic construct]
GI:8922871 GenBank AHD76865.1 318 Sequence 21085 from patent US 8586006
GI:89257335 RefSeq XP_006717519.1 265 PREDICTED: S-acyl fatty acid synthase thioesterase, medium chain isoform X1 [Homo sapiens]
GI:89257335 SwissProt Q9NV23.1 265 RecName: Full=S-acyl fatty acid synthase thioesterase, medium chain; AltName: Full=Augmented in rheumatoid arthritis 1; Short=AURA1; AltName: Full=Oleoyl-ACP hydrolase; AltName: Full=Thioesterase II; AltName: Full=Thioesterase domain-containing protein 1 [Homo sapiens]
GI:8922871 tpd FAA00320.1 318 TPA: augmented in rheumatoid arthritis 1 [Homo sapiens]

Related Sequences to LMP001809 proteins

Reference Database Accession Length Protein Name
GI:8922871 DBBJ BAA91937.1 265 unnamed protein product [Homo sapiens]
GI:89257335 DBBJ BAA92007.1 318 unnamed protein product [Homo sapiens]
GI:89257335 EMBL CAD35034.1 265 unnamed protein product [Homo sapiens]
GI:8922871 EMBL CAE89822.1 265 unnamed protein product [Homo sapiens]
GI:89257335 GenBank AAQ52096.1 318 Sequence 16 from patent US 6593099
GI:8922871 GenBank EAW86245.1 265 thioesterase domain containing 1, isoform CRA_b [Homo sapiens]
GI:8922871 GenBank ADQ33115.1 265 oleoyl-ACP hydrolase, partial [synthetic construct]
GI:8922871 GenBank EHH18904.1 318 hypothetical protein EGK_19475 [Macaca mulatta]
GI:89257335 GenBank AHD76865.1 318 Sequence 21085 from patent US 8586006
GI:89257335 GenBank AIC56665.1 265 OLAH, partial [synthetic construct]
GI:8922871 RefSeq NP_001034791.1 265 S-acyl fatty acid synthase thioesterase, medium chain isoform 2 [Homo sapiens]
GI:89257335 tpd FAA00320.1 318 TPA: augmented in rheumatoid arthritis 1 [Homo sapiens]