Gene/Proteome Database (LMPD)
Proteins
phosphatidylethanolamine-binding protein 1 preproprotein | |
---|---|
Refseq ID | NP_002558 |
Protein GI | 4505621 |
UniProt ID | P30086 |
mRNA ID | NM_002567 |
Length | 187 |
RefSeq Status | VALIDATED |
MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK | |
mat_peptide: 2..12 product: Hippocampal cholinergic neurostimulating peptide experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P30086.3) calculated_mol_wt: 1198 peptide sequence: PVDLSKWSGPL |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylethanolamine binding protein 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
GO:0005634 | IDA:UniProt | C | nucleus |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0019899 | IPI:UniProtKB | F | enzyme binding |
GO:0008429 | TAS:ProtInc | F | phosphatidylethanolamine binding |
GO:0044822 | IDA:UniProtKB | F | poly(A) RNA binding |
GO:0019901 | IPI:UniProtKB | F | protein kinase binding |
GO:0004867 | IEA:UniProtKB-KW | F | serine-type endopeptidase inhibitor activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylethanolamine binding protein 1
Protein Entry
PEBP1_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Function | Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation. {ECO:0000250, ECO:0000269|PubMed:18294816}. |
Function | HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor (By similarity). {ECO:0000250}. |
Interaction | P04049:RAF1; NbExp=7; IntAct=EBI-716384, EBI-365996; |
Similarity | Belongs to the phosphatidylethanolamine-binding protein family. {ECO:0000305}. |
Subcellular Location | Cytoplasm {ECO:0000250}. |
Subunit | Has a tendency to form dimers by disulfide cross-linking (By similarity). Interacts with RAF1 and this interaction is enhanced if RAF1 is phosphorylated on residues 'Ser-338', 'Ser- 339', 'Tyr-340' and 'Tyr-341'. Interacts with ALOX15; in response to IL13/interleukin-13, prevents the interaction of PEBP1 with RAF1 to activate the ERK signaling cascade. {ECO:0000250, ECO:0000269|PubMed:10490027, ECO:0000269|PubMed:18294816, ECO:0000269|PubMed:21831839}. |
Web Resource | Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/PEBP1ID44021ch12q24.html"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001830 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
4505621 | RefSeq | NP_002558 | 187 | phosphatidylethanolamine-binding protein 1 preproprotein |
Identical Sequences to LMP001830 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4505621 | GenBank | JAA17529.1 | 187 | phosphatidylethanolamine binding protein 1 [Pan troglodytes] |
GI:4505621 | GenBank | JAA17530.1 | 187 | phosphatidylethanolamine binding protein 1 [Pan troglodytes] |
GI:4505621 | GenBank | JAA28392.1 | 187 | phosphatidylethanolamine binding protein 1 [Pan troglodytes] |
GI:4505621 | GenBank | JAA40382.1 | 187 | phosphatidylethanolamine binding protein 1 [Pan troglodytes] |
GI:4505621 | GenBank | JAA40383.1 | 187 | phosphatidylethanolamine binding protein 1 [Pan troglodytes] |
GI:4505621 | GenBank | AGA52055.1 | 187 | Sequence 42 from patent US 8329399 |
Related Sequences to LMP001830 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4505621 | EMBL | CAD33310.1 | 233 | unnamed protein product [Homo sapiens] |
GI:4505621 | GenBank | AAB32876.1 | 186 | neuropolypeptide h3 [Homo sapiens] |
GI:4505621 | GenBank | ACK24436.1 | 223 | Sequence 12 from patent US 7452678 |
GI:4505621 | GenBank | JAB39754.1 | 187 | phosphatidylethanolamine-binding protein 1 preproprotein [Callithrix jacchus] |
GI:4505621 | RefSeq | XP_004054017.1 | 187 | PREDICTED: phosphatidylethanolamine-binding protein 1 [Gorilla gorilla gorilla] |
GI:4505621 | RefSeq | XP_509413.3 | 266 | PREDICTED: phosphatidylethanolamine-binding protein 1 [Pan troglodytes] |