Gene/Proteome Database (LMPD)
LMPD ID
LMP001844
Gene ID
Species
Homo sapiens (Human)
Gene Name
arachidonate 5-lipoxygenase-activating protein
Gene Symbol
Synonyms
FLAP
Alternate Names
arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein
Chromosome
13
Map Location
13q12
Summary
This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2011]
Orthologs
Proteins
| arachidonate 5-lipoxygenase-activating protein isoform 1 | |
|---|---|
| Refseq ID | NP_001620 |
| Protein GI | 15718675 |
| UniProt ID | P20292 |
| mRNA ID | NM_001629 |
| Length | 161 |
| RefSeq Status | REVIEWED |
| MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP | |
| arachidonate 5-lipoxygenase-activating protein isoform 2 | |
|---|---|
| Refseq ID | NP_001191335 |
| Protein GI | 324711029 |
| UniProt ID | P20292 |
| mRNA ID | NM_001204406 |
| Length | 218 |
| RefSeq Status | REVIEWED |
| MLTFNHDAPWHTQKTLKTSEFGKSFGTLGHIGNISHQCWAGCAAGGRAVLSGEPEANMDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP | |
Gene Information
Entrez Gene ID
Gene Name
arachidonate 5-lipoxygenase-activating protein
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005635 | IDA:UniProtKB | C | nuclear envelope |
| GO:0031965 | IDA:UniProtKB | C | nuclear membrane |
| GO:0050544 | IDA:UniProtKB | F | arachidonic acid binding |
| GO:0008047 | IEA:InterPro | F | enzyme activator activity |
| GO:0047485 | IPI:UniProtKB | F | protein N-terminus binding |
| GO:0019369 | TAS:Reactome | P | arachidonic acid metabolic process |
| GO:0071277 | IDA:UniProtKB | P | cellular response to calcium ion |
| GO:0019370 | IDA:UniProtKB | P | leukotriene biosynthetic process |
| GO:0006691 | TAS:Reactome | P | leukotriene metabolic process |
| GO:0002540 | IEA:Ensembl | P | leukotriene production involved in inflammatory response |
| GO:2001300 | TAS:Reactome | P | lipoxin metabolic process |
| GO:0019372 | TAS:Reactome | P | lipoxygenase pathway |
| GO:0002675 | IEA:Ensembl | P | positive regulation of acute inflammatory response |
| GO:0070207 | IPI:UniProtKB | P | protein homotrimerization |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150209 | Synthesis of 5-eicosatetraenoic acids |
| REACT_150420 | Synthesis of Leukotrienes (LT) and Eoxins (EX) |
| REACT_150320 | Synthesis of Lipoxins (LX) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
arachidonate 5-lipoxygenase-activating protein
Protein Entry
AL5AP_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Disease | Ischemic stroke (ISCHSTR) [MIM |
| Disease | Note=Genetic variations in ALOX5AP may be associated with susceptibility to myocardial infarction. Involvement in myocardial infarction is however unclear: according to some authors (PubMed:14770184), a 4-SNP haplotype in ALOX5AP confers risk of myocardial infarction, while according to other (PubMed:17304054) ALOX5AP is not implicated in this condition. |
| Domain | The C-terminal part after residue 140 is mostly unstructured. |
| Function | Required for leukotriene biosynthesis by ALOX5 (5- lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes. {ECO |
| Similarity | Belongs to the MAPEG family. |
| Subcellular Location | Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. |
| Subunit | Homotrimer. Interacts with LTC4S and ALOX5. |
| Web Resource | Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/alox5ap/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001844 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15718675 | RefSeq | NP_001620 | 161 | arachidonate 5-lipoxygenase-activating protein isoform 1 |
| 324711029 | RefSeq | NP_001191335 | 218 | arachidonate 5-lipoxygenase-activating protein isoform 2 |
Identical Sequences to LMP001844 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15718675 | GenBank | ADS96630.1 | 161 | Sequence 4 from patent US 7829535 |
| GI:15718675 | GenBank | AEK13688.1 | 161 | Sequence 100 from patent US 7972785 |
| GI:15718675 | GenBank | AFK96948.1 | 161 | Sequence 2 from patent US 8158362 |
| GI:15718675 | GenBank | AHD70012.1 | 161 | Sequence 2101 from patent US 8586006 |
| GI:15718675 | GenBank | AIC53987.1 | 161 | ALOX5AP, partial [synthetic construct] |
| GI:15718675 | RefSeq | XP_004054384.1 | 161 | PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform 2 [Gorilla gorilla gorilla] |
Related Sequences to LMP001844 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15718675 | GenBank | ABM85762.1 | 161 | arachidonate 5-lipoxygenase-activating protein, partial [synthetic construct] |
| GI:15718675 | GenBank | ACM84121.1 | 165 | Sequence 9619 from patent US 6812339 |
| GI:15718675 | RefSeq | NP_001191335.1 | 218 | arachidonate 5-lipoxygenase-activating protein isoform 2 [Homo sapiens] |
| GI:324711029 | RefSeq | XP_003270291.1 | 220 | PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform 2 [Nomascus leucogenys] |
| GI:15718675 | RefSeq | XP_001141625.2 | 218 | PREDICTED: arachidonate 5-lipoxygenase-activating protein [Pan troglodytes] |
| GI:324711029 | RefSeq | XP_001141625.2 | 218 | PREDICTED: arachidonate 5-lipoxygenase-activating protein [Pan troglodytes] |
| GI:15718675 | RefSeq | XP_003826909.1 | 218 | PREDICTED: arachidonate 5-lipoxygenase-activating protein [Pan paniscus] |
| GI:324711029 | RefSeq | XP_003826909.1 | 218 | PREDICTED: arachidonate 5-lipoxygenase-activating protein [Pan paniscus] |
| GI:324711029 | RefSeq | XP_003919757.1 | 222 | PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform X1 [Saimiri boliviensis boliviensis] |
| GI:324711029 | RefSeq | XP_004054383.1 | 218 | PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform 1 [Gorilla gorilla gorilla] |
| GI:15718675 | RefSeq | XP_004054383.1 | 218 | PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform 1 [Gorilla gorilla gorilla] |
| GI:324711029 | RefSeq | XP_005585644.1 | 218 | PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform X1 [Macaca fascicularis] |