Gene/Proteome Database (LMPD)

LMPD ID
LMP001844
Gene ID
Species
Homo sapiens (Human)
Gene Name
arachidonate 5-lipoxygenase-activating protein
Gene Symbol
Synonyms
FLAP
Alternate Names
arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein
Chromosome
13
Map Location
13q12
Summary
This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2011]
Orthologs

Proteins

arachidonate 5-lipoxygenase-activating protein isoform 1
Refseq ID NP_001620
Protein GI 15718675
UniProt ID P20292
mRNA ID NM_001629
Length 161
RefSeq Status REVIEWED
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
arachidonate 5-lipoxygenase-activating protein isoform 2
Refseq ID NP_001191335
Protein GI 324711029
UniProt ID P20292
mRNA ID NM_001204406
Length 218
RefSeq Status REVIEWED
MLTFNHDAPWHTQKTLKTSEFGKSFGTLGHIGNISHQCWAGCAAGGRAVLSGEPEANMDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP

Gene Information

Entrez Gene ID
Gene Name
arachidonate 5-lipoxygenase-activating protein
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:UniProtKB C membrane
GO:0005635 IDA:UniProtKB C nuclear envelope
GO:0031965 IDA:UniProtKB C nuclear membrane
GO:0050544 IDA:UniProtKB F arachidonic acid binding
GO:0008047 IEA:InterPro F enzyme activator activity
GO:0047485 IPI:UniProtKB F protein N-terminus binding
GO:0019369 TAS:Reactome P arachidonic acid metabolic process
GO:0071277 IDA:UniProtKB P cellular response to calcium ion
GO:0019370 IDA:UniProtKB P leukotriene biosynthetic process
GO:0006691 TAS:Reactome P leukotriene metabolic process
GO:0002540 IEA:Ensembl P leukotriene production involved in inflammatory response
GO:2001300 TAS:Reactome P lipoxin metabolic process
GO:0019372 TAS:Reactome P lipoxygenase pathway
GO:0002675 IEA:Ensembl P positive regulation of acute inflammatory response
GO:0070207 IPI:UniProtKB P protein homotrimerization
GO:0044281 TAS:Reactome P small molecule metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_150209 Synthesis of 5-eicosatetraenoic acids
REACT_150420 Synthesis of Leukotrienes (LT) and Eoxins (EX)
REACT_150320 Synthesis of Lipoxins (LX)

Domain Information

InterPro Annotations

Accession Description
IPR001446 5-lipoxygenase-activating protein
IPR018295 FLAP/GST2/LTC4S, conserved site
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
arachidonate 5-lipoxygenase-activating protein
Protein Entry
AL5AP_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Disease Ischemic stroke (ISCHSTR) [MIM
Disease Note=Genetic variations in ALOX5AP may be associated with susceptibility to myocardial infarction. Involvement in myocardial infarction is however unclear: according to some authors (PubMed:14770184), a 4-SNP haplotype in ALOX5AP confers risk of myocardial infarction, while according to other (PubMed:17304054) ALOX5AP is not implicated in this condition.
Domain The C-terminal part after residue 140 is mostly unstructured.
Function Required for leukotriene biosynthesis by ALOX5 (5- lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes. {ECO
Similarity Belongs to the MAPEG family.
Subcellular Location Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Subunit Homotrimer. Interacts with LTC4S and ALOX5.
Web Resource Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/alox5ap/";

Identical and Related Proteins

Unique RefSeq proteins for LMP001844 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15718675 RefSeq NP_001620 161 arachidonate 5-lipoxygenase-activating protein isoform 1
324711029 RefSeq NP_001191335 218 arachidonate 5-lipoxygenase-activating protein isoform 2

Identical Sequences to LMP001844 proteins

Reference Database Accession Length Protein Name
GI:15718675 GenBank ADS96630.1 161 Sequence 4 from patent US 7829535
GI:15718675 GenBank AEK13688.1 161 Sequence 100 from patent US 7972785
GI:15718675 GenBank AFK96948.1 161 Sequence 2 from patent US 8158362
GI:15718675 GenBank AHD70012.1 161 Sequence 2101 from patent US 8586006
GI:15718675 GenBank AIC53987.1 161 ALOX5AP, partial [synthetic construct]
GI:15718675 RefSeq XP_004054384.1 161 PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform 2 [Gorilla gorilla gorilla]

Related Sequences to LMP001844 proteins

Reference Database Accession Length Protein Name
GI:15718675 GenBank ABM85762.1 161 arachidonate 5-lipoxygenase-activating protein, partial [synthetic construct]
GI:15718675 GenBank ACM84121.1 165 Sequence 9619 from patent US 6812339
GI:15718675 RefSeq NP_001191335.1 218 arachidonate 5-lipoxygenase-activating protein isoform 2 [Homo sapiens]
GI:324711029 RefSeq XP_003270291.1 220 PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform 2 [Nomascus leucogenys]
GI:15718675 RefSeq XP_001141625.2 218 PREDICTED: arachidonate 5-lipoxygenase-activating protein [Pan troglodytes]
GI:324711029 RefSeq XP_001141625.2 218 PREDICTED: arachidonate 5-lipoxygenase-activating protein [Pan troglodytes]
GI:15718675 RefSeq XP_003826909.1 218 PREDICTED: arachidonate 5-lipoxygenase-activating protein [Pan paniscus]
GI:324711029 RefSeq XP_003826909.1 218 PREDICTED: arachidonate 5-lipoxygenase-activating protein [Pan paniscus]
GI:324711029 RefSeq XP_003919757.1 222 PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform X1 [Saimiri boliviensis boliviensis]
GI:324711029 RefSeq XP_004054383.1 218 PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform 1 [Gorilla gorilla gorilla]
GI:15718675 RefSeq XP_004054383.1 218 PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform 1 [Gorilla gorilla gorilla]
GI:324711029 RefSeq XP_005585644.1 218 PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform X1 [Macaca fascicularis]