Gene/Proteome Database (LMPD)
LMPD ID
LMP001862
Gene ID
Species
Homo sapiens (Human)
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Gene Symbol
Synonyms
3BETAHSD; HSD3B; HSDB3; HSDB3A; I; SDR11E1
Alternate Names
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3-beta-HSD I; progesterone reductase; steroid Delta-isomerase; trophoblast antigen FDO161G; delta-5-3-ketosteroid isomerase; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5)-steroid dehydrogenase; short chain dehydrogenase/reductase family 11E, member 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1
Chromosome
1
Map Location
1p13.1
EC Number
1.1.1.145
Proteins
| 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 | |
|---|---|
| Refseq ID | NP_000853 |
| Protein GI | 4504507 |
| UniProt ID | P14060 |
| mRNA ID | NM_000862 |
| Length | 373 |
| RefSeq Status | VALIDATED |
| MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ | |
Gene Information
Entrez Gene ID
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005743 | IDA:UniProtKB | C | mitochondrial inner membrane |
| GO:0005758 | IDA:UniProtKB | C | mitochondrial intermembrane space |
| GO:0030868 | ISS:UniProtKB | C | smooth endoplasmic reticulum membrane |
| GO:0003854 | ISS:UniProtKB | F | 3-beta-hydroxy-delta5-steroid dehydrogenase activity |
| GO:0004769 | ISS:UniProtKB | F | steroid delta-isomerase activity |
| GO:0006702 | TAS:UniProtKB | P | androgen biosynthetic process |
| GO:0006703 | TAS:UniProtKB | P | estrogen biosynthetic process |
| GO:0006704 | TAS:Reactome | P | glucocorticoid biosynthetic process |
| GO:0006705 | TAS:Reactome | P | mineralocorticoid biosynthetic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0006694 | ISS:UniProtKB | P | steroid biosynthetic process |
| GO:0008202 | TAS:Reactome | P | steroid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Protein Entry
3BHS1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A 3-beta-hydroxy-Delta(5)-steroid + NAD(+) = a 3-oxo-Delta(5)-steroid + NADH. |
| Catalytic Activity | A 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)- steroid. |
| Function | 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. Efficiently catalyzes the transformation of pregnenolone to progesterone, 17-alpha-hydroxypregnenolone to 17- alpha-hydroxyprogesterone, DHEA to 4-androstenedione, dihydrotestosterone to 5-alpha-androstane-3 beta,17 beta-diol, dehydroepiandrosterone to androstenedione and 5-alpha-androstan-3 beta,17 beta-diol to 5-alpha-dihydrotestosterone. |
| Pathway | Lipid metabolism; steroid biosynthesis. |
| Sequence Caution | Sequence=AAA36001.1; Type=Erroneous gene model prediction; Evidence= ; |
| Similarity | Belongs to the 3-beta-HSD family. |
| Subcellular Location | Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. |
| Tissue Specificity | Placenta and skin. Predominantly expressed in mammary gland tissue. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001862 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4504507 | RefSeq | NP_000853 | 373 | 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 |
Identical Sequences to LMP001862 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4504507 | DBBJ | BAF84245.1 | 373 | unnamed protein product [Homo sapiens] |
| GI:4504507 | EMBL | CBH19320.1 | 373 | unnamed protein product [Homo sapiens] |
| GI:4504507 | GenBank | AAQ78790.1 | 373 | Sequence 40 from patent US 6376210 |
| GI:4504507 | GenBank | ACP57447.1 | 373 | Sequence 1576 from patent US 7482117 |
| GI:4504507 | GenBank | ADS31044.1 | 373 | Sequence 1576 from patent US 7781168 |
| GI:4504507 | GenBank | AHD69506.1 | 373 | Sequence 520 from patent US 8586006 |
Related Sequences to LMP001862 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4504507 | GenBank | AAA51831.1 | 373 | 3-beta-hydroxysteroid dehydrogenase/delta-5-delta-4-isomerase [Homo sapiens] |
| GI:4504507 | GenBank | AAH31999.1 | 373 | Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 [Homo sapiens] |
| GI:4504507 | GenBank | ABM82087.1 | 373 | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 [synthetic construct] |
| GI:4504507 | GenBank | ABM85268.1 | 373 | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, partial [synthetic construct] |
| GI:4504507 | GenBank | ACP57446.1 | 375 | Sequence 1575 from patent US 7482117 |
| GI:4504507 | GenBank | ADS31043.1 | 375 | Sequence 1575 from patent US 7781168 |