Gene/Proteome Database (LMPD)
LMPD ID
LMP001872
Gene ID
Species
Homo sapiens (Human)
Gene Name
ELOVL fatty acid elongase 3
Gene Symbol
Synonyms
CIG-30; CIG30
Alternate Names
elongation of very long chain fatty acids protein 3; ELOVL FA elongase 3; 3-keto acyl-CoA synthase ELOVL3; cold-inducible glycoprotein of 30 kDa; very-long-chain 3-oxoacyl-CoA synthase 3; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
Chromosome
10
Map Location
10q24.32
EC Number
2.3.1.199
Summary
This gene encodes a protein that belongs to the GNS1/SUR4 family. Members of this family play a role in elongation of long chain fatty acids to provide precursors for synthesis of sphingolipids and ceramides. [provided by RefSeq, Jul 2013]
Orthologs
Proteins
| elongation of very long chain fatty acids protein 3 | |
|---|---|
| Refseq ID | NP_689523 |
| Protein GI | 23097310 |
| UniProt ID | Q9HB03 |
| mRNA ID | NM_152310 |
| Length | 270 |
| RefSeq Status | REVIEWED |
| MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
| GO:0034625 | IDA:UniProtKB | P | fatty acid elongation, monounsaturated fatty acid |
| GO:0034626 | IDA:UniProtKB | P | fatty acid elongation, polyunsaturated fatty acid |
| GO:0019367 | IDA:UniProtKB | P | fatty acid elongation, saturated fatty acid |
| GO:0035338 | TAS:Reactome | P | long-chain fatty-acyl-CoA biosynthetic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0019432 | TAS:Reactome | P | triglyceride biosynthetic process |
| GO:0042761 | IDA:UniProtKB | P | very long-chain fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00062 | Fatty acid elongation |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_118789 | REV-ERBA represses gene expression |
| REACT_380 | Synthesis of very long-chain fatty acyl-CoAs |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Domain | The di-lysine motif may confer endoplasmic reticulum localization. |
| Function | Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs). Highest activity toward C18 acyl-CoAs, especially C18:0 acyl-CoAs. |
| Ptm | N-Glycosylated. |
| Similarity | Belongs to the ELO family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Testis. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001872 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 23097310 | RefSeq | NP_689523 | 270 | elongation of very long chain fatty acids protein 3 |
Identical Sequences to LMP001872 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:23097310 | GenBank | EAW49711.1 | 270 | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 [Homo sapiens] |
| GI:23097310 | GenBank | ABY03472.1 | 270 | Sequence 9 from patent US 7297523 |
| GI:23097310 | GenBank | ADQ31862.1 | 270 | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3, partial [synthetic construct] |
| GI:23097310 | GenBank | AHE01995.1 | 270 | Sequence 59844 from patent US 8586006 |
| GI:23097310 | GenBank | AIC52452.1 | 270 | ELOVL3, partial [synthetic construct] |
| GI:23097310 | SwissProt | Q9HB03.2 | 270 | RecName: Full=Elongation of very long chain fatty acids protein 3; AltName: Full=3-keto acyl-CoA synthase ELOVL3; AltName: Full=Cold-inducible glycoprotein of 30 kDa; AltName: Full=ELOVL fatty acid elongase 3; Short=ELOVL FA elongase 3; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 3 [Homo sapiens] |
Related Sequences to LMP001872 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:23097310 | GenBank | JAA11492.1 | 270 | elongation of very long chain fatty acids-like 3 [Pan troglodytes] |
| GI:23097310 | GenBank | JAA28378.1 | 270 | elongation of very long chain fatty acids-like 3 [Pan troglodytes] |
| GI:23097310 | RefSeq | XP_003825560.1 | 270 | PREDICTED: elongation of very long chain fatty acids protein 3 [Pan paniscus] |
| GI:23097310 | RefSeq | XP_004050059.1 | 270 | PREDICTED: elongation of very long chain fatty acids protein 3 [Gorilla gorilla gorilla] |
| GI:23097310 | RefSeq | XP_009457398.1 | 270 | PREDICTED: elongation of very long chain fatty acids protein 3 isoform X1 [Pan troglodytes] |
| GI:23097310 | RefSeq | XP_009457399.1 | 270 | PREDICTED: elongation of very long chain fatty acids protein 3 isoform X1 [Pan troglodytes] |