Gene/Proteome Database (LMPD)

LMPD ID
LMP001872
Gene ID
Species
Homo sapiens (Human)
Gene Name
ELOVL fatty acid elongase 3
Gene Symbol
Synonyms
CIG-30; CIG30
Alternate Names
elongation of very long chain fatty acids protein 3; ELOVL FA elongase 3; 3-keto acyl-CoA synthase ELOVL3; cold-inducible glycoprotein of 30 kDa; very-long-chain 3-oxoacyl-CoA synthase 3; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
Chromosome
10
Map Location
10q24.32
EC Number
2.3.1.199
Summary
This gene encodes a protein that belongs to the GNS1/SUR4 family. Members of this family play a role in elongation of long chain fatty acids to provide precursors for synthesis of sphingolipids and ceramides. [provided by RefSeq, Jul 2013]
Orthologs

Proteins

elongation of very long chain fatty acids protein 3
Refseq ID NP_689523
Protein GI 23097310
UniProt ID Q9HB03
mRNA ID NM_152310
Length 270
RefSeq Status REVIEWED
MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ

Gene Information

Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 3
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0034625 IDA:UniProtKB P fatty acid elongation, monounsaturated fatty acid
GO:0034626 IDA:UniProtKB P fatty acid elongation, polyunsaturated fatty acid
GO:0019367 IDA:UniProtKB P fatty acid elongation, saturated fatty acid
GO:0035338 TAS:Reactome P long-chain fatty-acyl-CoA biosynthetic process
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0019432 TAS:Reactome P triglyceride biosynthetic process
GO:0042761 IDA:UniProtKB P very long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00062 Fatty acid elongation

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_118789 REV-ERBA represses gene expression
REACT_380 Synthesis of very long-chain fatty acyl-CoAs

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL fatty acid elongase 3
Protein Entry
ELOV3_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Domain The di-lysine motif may confer endoplasmic reticulum localization.
Function Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs). Highest activity toward C18 acyl-CoAs, especially C18:0 acyl-CoAs.
Ptm N-Glycosylated.
Similarity Belongs to the ELO family.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Tissue Specificity Testis.

Identical and Related Proteins

Unique RefSeq proteins for LMP001872 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
23097310 RefSeq NP_689523 270 elongation of very long chain fatty acids protein 3

Identical Sequences to LMP001872 proteins

Reference Database Accession Length Protein Name
GI:23097310 GenBank EAW49711.1 270 elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 [Homo sapiens]
GI:23097310 GenBank ABY03472.1 270 Sequence 9 from patent US 7297523
GI:23097310 GenBank ADQ31862.1 270 elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3, partial [synthetic construct]
GI:23097310 GenBank AHE01995.1 270 Sequence 59844 from patent US 8586006
GI:23097310 GenBank AIC52452.1 270 ELOVL3, partial [synthetic construct]
GI:23097310 SwissProt Q9HB03.2 270 RecName: Full=Elongation of very long chain fatty acids protein 3; AltName: Full=3-keto acyl-CoA synthase ELOVL3; AltName: Full=Cold-inducible glycoprotein of 30 kDa; AltName: Full=ELOVL fatty acid elongase 3; Short=ELOVL FA elongase 3; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 3 [Homo sapiens]

Related Sequences to LMP001872 proteins

Reference Database Accession Length Protein Name
GI:23097310 GenBank JAA11492.1 270 elongation of very long chain fatty acids-like 3 [Pan troglodytes]
GI:23097310 GenBank JAA28378.1 270 elongation of very long chain fatty acids-like 3 [Pan troglodytes]
GI:23097310 RefSeq XP_003825560.1 270 PREDICTED: elongation of very long chain fatty acids protein 3 [Pan paniscus]
GI:23097310 RefSeq XP_004050059.1 270 PREDICTED: elongation of very long chain fatty acids protein 3 [Gorilla gorilla gorilla]
GI:23097310 RefSeq XP_009457398.1 270 PREDICTED: elongation of very long chain fatty acids protein 3 isoform X1 [Pan troglodytes]
GI:23097310 RefSeq XP_009457399.1 270 PREDICTED: elongation of very long chain fatty acids protein 3 isoform X1 [Pan troglodytes]