Gene/Proteome Database (LMPD)

LMPD ID
LMP001910
Gene ID
10432
Species
Homo sapiens (Human)
Gene Name
RNA binding motif protein 14
Gene Symbol
RBM14
Synonyms
COAA; PSP2; SIP; SYTIP1; TMEM137
Alternate Names
RNA-binding protein 14; paraspeckle protein 2; SYT-interacting protein; transmembrane protein 137; synaptotagmin-interacting protein; RRM-containing coactivator activator/modulator
Chromosome
11
Map Location
11q13.2
Summary
This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene. [provided by RefSeq, Oct 2011]
Orthologs
View orthologs and multiple alignments for RBM14

Proteins

RNA-binding protein 14 isoform 1
Refseq ID NP_006319
Protein GI 5454064
UniProt ID Q96PK6
mRNA ID NM_006328
Length 669
RefSeq Status REVIEWED
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM
RNA-binding protein 14 isoform 2
Refseq ID NP_001185765
Protein GI 311771525
UniProt ID Q96PK6
mRNA ID NM_001198836
Length 156
RefSeq Status REVIEWED
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGMVPTGV
RNA-binding protein 14 isoform 3
Refseq ID NP_001185766
Protein GI 311771527
UniProt ID Q96PK6
mRNA ID NM_001198837
Length 119
RefSeq Status REVIEWED
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKGMVPTGV

Gene Information

Entrez Gene ID
10432
Gene Name
RNA binding motif protein 14
Gene Symbol
RBM14
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016592 NAS:UniProtKB C mediator complex
GO:0005634 IDA:HPA C nucleus
GO:0030529 TAS:UniProtKB C ribonucleoprotein complex
GO:0005667 IPI:UniProtKB C transcription factor complex
GO:0003723 NAS:UniProtKB F RNA binding
GO:0001104 NAS:UniProtKB F RNA polymerase II transcription cofactor activity
GO:0030374 IPI:UniProtKB F ligand-dependent nuclear receptor transcription coactivator activity
GO:0000166 IEA:InterPro F nucleotide binding
GO:0044822 IDA:UniProtKB F poly(A) RNA binding
GO:0030674 NAS:UniProtKB F protein binding, bridging
GO:0006310 NAS:UniProtKB P DNA recombination
GO:0006281 NAS:UniProtKB P DNA repair
GO:0006260 NAS:UniProtKB P DNA replication
GO:0042921 NAS:UniProtKB P glucocorticoid receptor signaling pathway
GO:0016575 IPI:UniProtKB P histone deacetylation
GO:0030520 NAS:UniProtKB P intracellular estrogen receptor signaling pathway
GO:0045944 IDA:UniProtKB P positive regulation of transcription from RNA polymerase II promoter
GO:0009725 TAS:UniProtKB P response to hormone
GO:0006366 NAS:GOC P transcription from RNA polymerase II promoter

Domain Information

InterPro Annotations

Accession Description
IPR012677 Nucleotide-binding alpha-beta plait domain
IPR000504 RNA recognition motif domain

UniProt Annotations

Entry Information

Gene Name
RNA binding motif protein 14
Protein Entry
RBM14_HUMAN
UniProt ID
Q96PK6
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=CoAA; IsoId=Q96PK6-1; Sequence=Displayed; Name=2; Synonyms=CoAM; IsoId=Q96PK6-2; Sequence=VSP_015078, VSP_015079; Name=3; IsoId=Q96PK6-3; Sequence=VSP_044641, VSP_044642; Note=No experimental confirmation available.; Name=4; IsoId=Q96PK6-4; Sequence=VSP_047109, VSP_047110; Name=5; IsoId=Q96PK6-5; Sequence=VSP_047494, VSP_047495;
Function Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.
Similarity Contains 2 RRM (RNA recognition motif) domains.
Subcellular Location Nucleus. Nucleus, nucleolus. Note=In punctate subnuclear structures often located adjacent to splicing speckles, called paraspeckles.
Subunit Isoform 1 interacts with NCOA6, CITED1 and XRCC5/KU86. Isoform 1 interacts with SS18 isoform 1. Isoform 1 interacts with SS18 isoform 2. {ECO
Tissue Specificity Expressed in all tissues tested, including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes.

Identical and Related Proteins

Unique RefSeq proteins for LMP001910 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
5454064 RefSeq NP_006319 669 RNA-binding protein 14 isoform 1
311771525 RefSeq NP_001185765 156 RNA-binding protein 14 isoform 2
311771527 RefSeq NP_001185766 119 RNA-binding protein 14 isoform 3

Identical Sequences to LMP001910 proteins

Reference Database Accession Length Protein Name
GI:5454064 GenBank AIC50620.1 669 RBM14, partial [synthetic construct]
GI:5454064 GenBank KFO28361.1 669 RNA-binding protein 14 [Fukomys damarensis]
GI:5454064 RefSeq XP_004051645.1 669 PREDICTED: RNA-binding protein 14 isoform 1 [Gorilla gorilla gorilla]
GI:5454064 RefSeq XP_005577186.1 669 PREDICTED: RNA-binding protein 14 isoform X1 [Macaca fascicularis]
GI:311771527 RefSeq XP_007461993.1 119 PREDICTED: RNA-binding protein 14 isoform X3 [Lipotes vexillifer]
GI:5454064 RefSeq XP_007971339.1 669 PREDICTED: RNA-binding protein 14 isoform X1 [Chlorocebus sabaeus]
GI:311771525 RefSeq XP_008050163.1 156 PREDICTED: RNA-binding protein 14 isoform X2 [Tarsius syrichta]
GI:311771527 RefSeq XP_008050164.1 119 PREDICTED: RNA-binding protein 14 isoform X3 [Tarsius syrichta]
GI:311771525 RefSeq XP_008145115.1 156 PREDICTED: RNA-binding protein 14 isoform X2 [Eptesicus fuscus]
GI:311771527 RefSeq XP_008145116.1 119 PREDICTED: RNA-binding protein 14 isoform X3 [Eptesicus fuscus]
GI:311771525 RefSeq XP_008271854.1 156 PREDICTED: RNA-binding protein 14 isoform X3 [Oryctolagus cuniculus]
GI:311771527 RefSeq XP_008271857.1 119 PREDICTED: RNA-binding protein 14 isoform X4 [Oryctolagus cuniculus]
GI:311771525 RefSeq XP_009244377.1 156 PREDICTED: RNA-binding protein 14 isoform X1 [Pongo abelii]
GI:311771527 RefSeq XP_009244378.1 119 PREDICTED: RNA-binding protein 14 isoform X2 [Pongo abelii]
GI:5454064 RefSeq XP_010364706.1 669 PREDICTED: RNA-binding protein 14 isoform X1 [Rhinopithecus roxellana]
GI:311771525 RefSeq XP_010350292.1 156 PREDICTED: RNA-binding protein 14 isoform X3 [Saimiri boliviensis boliviensis]
GI:311771527 RefSeq XP_010350294.1 119 PREDICTED: RNA-binding protein 14 isoform X5 [Saimiri boliviensis boliviensis]
GI:311771525 RefSeq XP_010634154.1 156 PREDICTED: RNA-binding protein 14 isoform X5 [Fukomys damarensis]

Related Sequences to LMP001910 proteins

Reference Database Accession Length Protein Name
GI:5454064 GenBank AAK77961.1 669 coactivator activator [Homo sapiens]
GI:5454064 GenBank JAA08683.1 669 RNA binding motif protein 14 [Pan troglodytes]
GI:5454064 GenBank JAA16031.1 669 RNA binding motif protein 14 [Pan troglodytes]
GI:5454064 GenBank JAA25510.1 669 RNA binding motif protein 14 [Pan troglodytes]
GI:5454064 GenBank JAA38688.1 669 RNA binding motif protein 14 [Pan troglodytes]
GI:311771525 RefSeq XP_004852341.1 156 PREDICTED: RNA-binding protein 4B-like isoform X7 [Heterocephalus glaber]
GI:311771527 RefSeq XP_004852345.1 119 PREDICTED: RNA-binding protein 4B-like isoform X11 [Heterocephalus glaber]
GI:311771525 RefSeq XP_005064102.1 156 PREDICTED: RNA-binding protein 4B-like isoform X6 [Mesocricetus auratus]
GI:311771527 RefSeq XP_005064104.1 119 PREDICTED: RNA-binding protein 4B-like isoform X8 [Mesocricetus auratus]
GI:311771525 RefSeq XP_005227121.1 156 PREDICTED: RNA-binding protein 14 isoform X2 [Bos taurus]
GI:311771527 RefSeq XP_005227123.1 119 PREDICTED: RNA-binding protein 14 isoform X4 [Bos taurus]
GI:311771525 RefSeq XP_005351744.1 156 PREDICTED: RNA-binding protein 14 isoform X2 [Microtus ochrogaster]
GI:311771527 RefSeq XP_005351745.1 119 PREDICTED: RNA-binding protein 14 isoform X3 [Microtus ochrogaster]
GI:5454064 RefSeq XP_005333426.1 669 PREDICTED: RNA-binding protein 14 isoform X1 [Ictidomys tridecemlineatus]
GI:311771525 RefSeq XP_005968906.1 156 PREDICTED: RNA-binding protein 14 isoform X2 [Pantholops hodgsonii]
GI:311771527 RefSeq XP_005968907.1 119 PREDICTED: RNA-binding protein 14 isoform X3 [Pantholops hodgsonii]
GI:311771525 RefSeq XP_006044410.1 156 PREDICTED: RNA-binding protein 14 isoform X2 [Bubalus bubalis]
GI:311771527 RefSeq XP_006044411.1 119 PREDICTED: RNA-binding protein 14 isoform X3 [Bubalus bubalis]