Gene/Proteome Database (LMPD)
LMPD ID
LMP001912
Gene ID
Species
Homo sapiens (Human)
Gene Name
pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
Gene Symbol
Synonyms
FAPP1
Alternate Names
pleckstrin homology domain-containing family A member 3; FAPP-1; four-phosphate-adaptor protein 1; PH domain-containing family A member 3; phosphoinositol 4-phosphate adapter protein 1; phosphatidylinositol-four-phosphate adapter protein 1; pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 3
Chromosome
2
Map Location
2q31.2
Proteins
| pleckstrin homology domain-containing family A member 3 | |
|---|---|
| Refseq ID | NP_061964 |
| Protein GI | 54792084 |
| UniProt ID | Q9HB20 |
| mRNA ID | NM_019091 |
| Length | 300 |
| RefSeq Status | VALIDATED |
| MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS | |
Gene Information
Entrez Gene ID
Gene Name
pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:HPA | C | Golgi apparatus |
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0005545 | IEA:Ensembl | F | 1-phosphatidylinositol binding |
| GO:0005543 | IDA:UniProtKB | F | phospholipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
Protein Entry
PKHA3_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Domain | The PH domain of FAPPS binds the small GTPase ARF1 and phosphatidylinositol-4-phosphate (PtdIns4P) with high selectivity, and is required for recruitment of FAPPs to the trans-Golgi network (TGN). |
| Function | Involved in Golgi to cell surface membrane traffic. Induces membrane tubulation. Binds preferentially to phosphatidylinositol 4-phosphate (PtdIns4P). |
| Sequence Caution | Sequence=BAA90927.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Contains 1 PH domain. {ECO |
| Subcellular Location | Golgi apparatus, trans-Golgi network membrane ; Peripheral membrane protein . |
| Subunit | Interacts with GTP-bound ARF1. |
| Tissue Specificity | Widely expressed. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001912 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 54792084 | RefSeq | NP_061964 | 300 | pleckstrin homology domain-containing family A member 3 |
Identical Sequences to LMP001912 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:54792084 | GenBank | JAA07025.1 | 300 | pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 [Pan troglodytes] |
| GI:54792084 | GenBank | JAA20616.1 | 300 | pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 [Pan troglodytes] |
| GI:54792084 | GenBank | JAA29909.1 | 300 | pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 [Pan troglodytes] |
| GI:54792084 | GenBank | JAA33942.1 | 300 | pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 [Pan troglodytes] |
| GI:54792084 | GenBank | AHD70218.1 | 300 | Sequence 2307 from patent US 8586006 |
| GI:54792084 | RefSeq | XP_004032918.1 | 300 | PREDICTED: pleckstrin homology domain-containing family A member 3 [Gorilla gorilla gorilla] |
Related Sequences to LMP001912 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:54792084 | GenBank | AAG15199.1 | 300 | Phosphoinositol 4-phosphate Adaptor Protein-1 [Homo sapiens] |
| GI:54792084 | GenBank | EHH54989.1 | 300 | hypothetical protein EGM_04108 [Macaca fascicularis] |
| GI:54792084 | GenBank | AFE79772.1 | 300 | pleckstrin homology domain-containing family A member 3 [Macaca mulatta] |
| GI:54792084 | GenBank | AFI33247.1 | 300 | pleckstrin homology domain-containing family A member 3 [Macaca mulatta] |
| GI:54792084 | RefSeq | XP_002812680.1 | 300 | PREDICTED: pleckstrin homology domain-containing family A member 3 [Pongo abelii] |
| GI:54792084 | RefSeq | XP_007963662.1 | 300 | PREDICTED: pleckstrin homology domain-containing family A member 3 [Chlorocebus sabaeus] |