Gene/Proteome Database (LMPD)
LMPD ID
LMP001933
Gene ID
Species
Mus musculus (Mouse)
Gene Name
prostaglandin D2 synthase (brain)
Gene Symbol
Synonyms
21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3
Alternate Names
prostaglandin-H2 D-isomerase; PGD2 synthase; prostaglandin-D2 synthase; glutathione-independent PGD synthase; glutathione-independent PGD synthetase; lipocalin-type prostaglandin-D synthase; prostaglandin D2 synthase (21 kDa, brain)
Chromosome
2
Map Location
2 A3|2 17.28 cM
EC Number
5.3.99.2
Proteins
| prostaglandin-H2 D-isomerase precursor | |
|---|---|
| Refseq ID | NP_032989 |
| Protein GI | 119226208 |
| UniProt ID | O09114 |
| mRNA ID | NM_008963 |
| Length | 189 |
| RefSeq Status | VALIDATED |
| MAALRMLWMGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE | |
| sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2600 peptide sequence: MAALRMLWMGLVLLGLLGFPQTPA mat_peptide: 25..189 product: Prostaglandin-H2 D-isomerase experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O09114.1) calculated_mol_wt: 18484 peptide sequence: QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE | |
Gene Information
Entrez Gene ID
Gene Name
prostaglandin D2 synthase (brain)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | ISS:UniProtKB | C | Golgi apparatus |
| GO:0005576 | IDA:UniProtKB | C | extracellular region |
| GO:0005615 | IEA:Ensembl | C | extracellular space |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0005791 | ISS:UniProtKB | C | rough endoplasmic reticulum |
| GO:0005504 | IEA:Ensembl | F | fatty acid binding |
| GO:0004667 | IDA:UniProtKB | F | prostaglandin-D synthase activity |
| GO:0005501 | IDA:UniProtKB | F | retinoid binding |
| GO:0005215 | ISS:UniProtKB | F | transporter activity |
| GO:0001516 | IDA:UniProtKB | P | prostaglandin biosynthetic process |
| GO:0045187 | IDA:UniProtKB | P | regulation of circadian sleep/wake cycle, sleep |
| GO:0051384 | IEA:Ensembl | P | response to glucocorticoid |
| GO:0006810 | ISS:UniProtKB | P | transport |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY3DJ-35583 | biosynthesis of prostaglandins |
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin D2 synthase (brain)
Protein Entry
PTGDS_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O09114-1; Sequence=Displayed; Name=2; IsoId=O09114-2; Sequence=VSP_041029; Note=No experimental confirmation available.; |
| Biophysicochemical Properties | Kinetic parameters: KM=0.8 uM for prostaglandin H2 {ECO:0000269|PubMed:19546224}; Vmax=5.9 umol/min/mg enzyme {ECO:0000269|PubMed:19546224}; |
| Catalytic Activity | (5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy- 11-oxoprosta-5,13-dienoate. {ECO:0000269|PubMed:17715133, ECO:0000269|PubMed:19546224}. |
| Developmental Stage | Initially detected at 14.5 dpc in the mesenchymal cells of the brain. Later in development, observed in the choroid plexus and within single cells in the brain. |
| Domain | Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. {ECO:0000269|PubMed:17715133, ECO:0000269|PubMed:19546224, ECO:0000269|PubMed:19833210}. |
| Function | Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. {ECO:0000269|PubMed:10781097, ECO:0000269|PubMed:11751991, ECO:0000269|PubMed:12077186, ECO:0000269|PubMed:17715133, ECO:0000269|PubMed:19546224, ECO:0000269|PubMed:19833210, ECO:0000269|PubMed:8922532, ECO:0000269|PubMed:9892701}. |
| Induction | By IL-1 beta and thyroid hormone. Probably induced by dexamethasone, dihydrotestosterone, progesterone, retinoic acid and retinal. Repressed by the Notch-Hes signaling pathway. {ECO:0000269|PubMed:10899920}. |
| Sequence Caution | Sequence=BAA21769.1; Type=Frameshift; Positions=47; Evidence={ECO:0000305}; |
| Similarity | Belongs to the calycin superfamily. Lipocalin family. {ECO:0000305}. |
| Subcellular Location | Rough endoplasmic reticulum {ECO:0000250}. Nucleus membrane {ECO:0000250}. Golgi apparatus {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. Secreted {ECO:0000250}. Note=Detected on rough endoplasmic reticulum of arachnoid and menigioma cells. Localized to the nuclear envelope, Golgi apparatus, secretory vesicles and spherical cytoplasmic structures in arachnoid trabecular cells, and to circular cytoplasmic structures in meningeal macrophages and perivascular microglial cells. In oligodendrocytes, localized to the rough endoplasmic reticulum and nuclear envelope. In retinal pigment epithelial cells, localized to distinct cytoplasmic domains including the perinuclear region. Also secreted (By similarity). {ECO:0000250}. |
| Subunit | Monomer. {ECO:0000250}. |
| Tissue Specificity | Abundant in the brain and CNS, where it is expressed in tissues of the blood-brain barrier and secreted into the cerebro-spinal fluid. In the male reproductive system, it is expressed in the testis, efferent ducts and epididymis, and is secreted into the seminal fluid. In the eye, it is expressed in the pigmented epithelium of the retina and the nonpigmented epithelium of the ciliary body, and secreted into the aqueous humor. Low levels detected in various tissue fluids such as serum, normal urine, ascitic fluid and tear fluid. Also found in a number of other organs including the ear, heart and lung. {ECO:0000269|PubMed:11105911, ECO:0000269|PubMed:11751991, ECO:0000269|PubMed:8922532, ECO:0000269|PubMed:9892701}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001933 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 119226208 | RefSeq | NP_032989 | 189 | prostaglandin-H2 D-isomerase precursor |
Identical Sequences to LMP001933 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:119226208 | DBBJ | BAE20833.1 | 189 | unnamed protein product [Mus musculus] |
| GI:119226208 | GenBank | AAH43015.1 | 189 | Prostaglandin D2 synthase (brain) [Mus musculus] |
| GI:119226208 | GenBank | EDL08250.1 | 189 | prostaglandin D2 synthase (brain), isoform CRA_c [Mus musculus] |
| GI:119226208 | GenBank | EDL08251.1 | 189 | prostaglandin D2 synthase (brain), isoform CRA_c [Mus musculus] |
| GI:119226208 | RefSeq | XP_006497849.1 | 189 | PREDICTED: prostaglandin-H2 D-isomerase isoform X1 [Mus musculus] |
| GI:119226208 | RefSeq | XP_006497850.1 | 189 | PREDICTED: prostaglandin-H2 D-isomerase isoform X2 [Mus musculus] |
Related Sequences to LMP001933 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:119226208 | GenBank | AAA41839.1 | 189 | prostaglandin D synthetase [Rattus norvegicus] |
| GI:119226208 | GenBank | AAA41840.1 | 189 | prostaglandin H2 D-isomerase [Rattus norvegicus] |
| GI:119226208 | GenBank | EDL08248.1 | 214 | prostaglandin D2 synthase (brain), isoform CRA_a, partial [Mus musculus] |
| GI:119226208 | GenBank | EDL93575.1 | 189 | prostaglandin D2 synthase, isoform CRA_a [Rattus norvegicus] |
| GI:119226208 | GenBank | EDL93576.1 | 189 | prostaglandin D2 synthase, isoform CRA_a [Rattus norvegicus] |
| GI:119226208 | GenBank | AED45343.1 | 246 | Sequence 849 from patent US 7892730 |