Gene/Proteome Database (LMPD)
LMPD ID
LMP001946
Gene ID
Species
Homo sapiens (Human)
Gene Name
retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
Gene Symbol
Synonyms
ARSDR1; CGI82; HCBP12; MDT1; PSDR1; RALR1; SCALD; SDR7C1
Alternate Names
retinol dehydrogenase 11; retinal reductase 1; HCV core-binding protein HCBP12; prostate short-chain dehydrogenase reductase 1; prostate short-chain dehydrogenase/reductase 1; short chain dehydrogenase/reductase family 7C, member 1; androgen-regulated short-chain dehydrogenase/reductase 1
Chromosome
14
Map Location
14q24.1
EC Number
1.1.1.300
Summary
The protein encoded by this gene is an NADPH-dependent retinal reductase and a short-chain dehydrogenase/reductase. The encoded protein has no steroid dehydrogenase activity. [provided by RefSeq, Nov 2011]
Orthologs
Proteins
| retinol dehydrogenase 11 isoform 1 precursor | |
|---|---|
| Refseq ID | NP_057110 |
| Protein GI | 166795268 |
| UniProt ID | Q8TC12 |
| mRNA ID | NM_016026 |
| Length | 318 |
| RefSeq Status | REVIEWED |
| MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID | |
| sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2381 peptide sequence: MVELMFPLLLLLLPFLLYMA sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2381 peptide sequence: MVELMFPLLLLLLPFLLYMA | |
| retinol dehydrogenase 11 isoform 2 precursor | |
|---|---|
| Refseq ID | NP_001239579 |
| Protein GI | 358001101 |
| UniProt ID | Q8TC12 |
| mRNA ID | NM_001252650 |
| Length | 248 |
| RefSeq Status | REVIEWED |
| MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID | |
Gene Information
Entrez Gene ID
Gene Name
retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005622 | ISS:UniProtKB | C | intracellular |
| GO:0001917 | IEA:Ensembl | C | photoreceptor inner segment |
| GO:0052650 | IDA:MGI | F | NADP-retinol dehydrogenase activity |
| GO:0004745 | ISS:UniProtKB | F | retinol dehydrogenase activity |
| GO:0016062 | IEA:Ensembl | P | adaptation of rhodopsin mediated signaling |
| GO:0007603 | TAS:Reactome | P | phototransduction, visible light |
| GO:0042574 | IDA:MGI | P | retinal metabolic process |
| GO:0001523 | TAS:Reactome | P | retinoid metabolic process |
| GO:0042572 | ISS:UniProtKB | P | retinol metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00830 | Retinol metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_24968 | Retinoid metabolism and transport |
| REACT_160156 | The canonical retinoid cycle in rods (twilight vision) |
| REACT_160125 | Visual phototransduction |
Domain Information
UniProt Annotations
Entry Information
Gene Name
retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
Protein Entry
RDH11_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8TC12-1; Sequence=Displayed; Name=2; IsoId=Q8TC12-2; Sequence=VSP_008159; Note=No experimental confirmation available.; Name=3; IsoId=Q8TC12-3; Sequence=VSP_046403; Note=No experimental confirmation available.; |
| Biophysicochemical Properties | Kinetic parameters: KM=0.23 uM for NADPH ; KM=0.8 uM for NADP ; KM=0.5 uM for all-trans-retinal ; KM=0.62 uM for 13-cis-retinal ; KM=0.19 uM for 9-cis-retinal ; KM=1.3 uM for all-trans-retinol ; Vmax=18 nmol/min/mg enzyme with all-trans-retinal as substrate ; Vmax=7 nmol/min/mg enzyme with 13-cis-retinal as substrate ; Vmax=1.6 nmol/min/mg enzyme with 9-cis-retinal as substrate ; Vmax=0.95 nmol/min/mg enzyme with all-trans-retinol as substrate ; Note=Vmax is measured per mg microsomal protein.; |
| Catalytic Activity | All-trans-retinol + NADP(+) = all-trans- retinal + NADPH. |
| Function | Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. |
| Induction | By androgens in prostate cancer cells. |
| Ptm | Not glycosylated. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Single-pass type II membrane protein . |
| Tissue Specificity | Predominantly expressed in the epithelial cells of prostate, in both basal and luminal secretory cell populations. Expressed at low levels in spleen, thymus, testis, ovary, small intestine, colon, peripherical blood leukocytes, kidney, adrenal gland and fetal liver. Not detected in prostatic fibromuscular stromal cells, endothelial cells, or infiltrating lymphocytes. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001946 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 166795268 | RefSeq | NP_057110 | 318 | retinol dehydrogenase 11 isoform 1 precursor |
| 358001101 | RefSeq | NP_001239579 | 248 | retinol dehydrogenase 11 isoform 2 precursor |
Identical Sequences to LMP001946 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:358001101 | DBBJ | BAG56871.1 | 248 | unnamed protein product [Homo sapiens] |
| GI:166795268 | GenBank | ACQ40983.1 | 318 | Sequence 339 from patent US 7517952 |
| GI:166795268 | GenBank | ADQ31650.1 | 318 | retinol dehydrogenase 11 (all-trans/9-cis/11-cis), partial [synthetic construct] |
| GI:166795268 | GenBank | AEF76168.1 | 318 | Sequence 339 from patent US 7939646 |
| GI:166795268 | GenBank | AIC56382.1 | 318 | RDH11, partial [synthetic construct] |
| GI:166795268 | GenBank | AIC63402.1 | 318 | RDH11, partial [synthetic construct] |
| GI:166795268 | RefSeq | XP_008976045.1 | 318 | PREDICTED: retinol dehydrogenase 11 [Pan paniscus] |
Related Sequences to LMP001946 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:166795268 | GenBank | ADC20498.1 | 318 | Sequence 982 from patent US 7638288 |
| GI:166795268 | GenBank | AED39256.1 | 318 | Sequence 1321 from patent US 7883858 |
| GI:166795268 | GenBank | JAA11318.1 | 318 | retinol dehydrogenase 11 (all-trans/9-cis/11-cis) [Pan troglodytes] |
| GI:166795268 | GenBank | JAA41944.1 | 318 | retinol dehydrogenase 11 (all-trans/9-cis/11-cis) [Pan troglodytes] |
| GI:166795268 | GenBank | AGD01459.1 | 318 | Sequence 982 from patent US 8338124 |
| GI:358001101 | RefSeq | XP_003263646.1 | 248 | PREDICTED: retinol dehydrogenase 11 isoform 3 [Nomascus leucogenys] |
| GI:358001101 | RefSeq | XP_004055383.1 | 248 | PREDICTED: retinol dehydrogenase 11 isoform 2 [Gorilla gorilla gorilla] |
| GI:358001101 | RefSeq | XP_004262199.1 | 246 | PREDICTED: retinol dehydrogenase 11 isoform 2 [Orcinus orca] |
| GI:358001101 | RefSeq | XP_004397644.1 | 247 | PREDICTED: retinol dehydrogenase 11 isoform 2 [Odobenus rosmarus divergens] |
| GI:358001101 | RefSeq | XP_005322876.1 | 246 | PREDICTED: retinol dehydrogenase 11 isoform X2 [Ictidomys tridecemlineatus] |
| GI:358001101 | RefSeq | XP_005561631.1 | 248 | PREDICTED: retinol dehydrogenase 11 isoform X3 [Macaca fascicularis] |
| GI:166795268 | RefSeq | XP_003314453.2 | 318 | PREDICTED: retinol dehydrogenase 11 [Pan troglodytes] |