Gene/Proteome Database (LMPD)
LMPD ID
LMP001983
Gene ID
Species
Homo sapiens (Human)
Gene Name
cytochrome P450, family 3, subfamily A, polypeptide 43
Gene Symbol
Synonyms
-
Alternate Names
cytochrome P450 3A43; cytochrome P450, subfamily IIIA, polypeptide 43
Chromosome
7
Map Location
7q21.1
EC Number
1.14.14.1
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The encoded protein has a low level of testosterone hydroxylase activity, and may play a role in aging mechanisms and cancer progression. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Orthologs
Proteins
cytochrome P450 3A43 isoform 1 | |
---|---|
Refseq ID | NP_073731 |
Protein GI | 12383060 |
UniProt ID | Q9HB55 |
mRNA ID | NM_022820 |
Length | 504 |
RefSeq Status | REVIEWED |
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNFDRECNEKYGEMWGLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGFLKSALSFAEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYTMDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP |
cytochrome P450 3A43 isoform 2 | |
---|---|
Refseq ID | NP_476436 |
Protein GI | 16933533 |
UniProt ID | Q9HB55 |
mRNA ID | NM_057095 |
Length | 503 |
RefSeq Status | REVIEWED |
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNFDRECNEKYGEMWGLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGFLKSALSFAEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYTMDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP |
cytochrome P450 3A43 isoform 3 | |
---|---|
Refseq ID | NP_476437 |
Protein GI | 16933535 |
UniProt ID | Q9HB55 |
mRNA ID | NM_057096 |
Length | 420 |
RefSeq Status | REVIEWED |
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNFDRECNEKYGEMWGLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGFLKSALSFAEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYTMDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERSH |
cytochrome P450 3A43 isoform 4 | |
---|---|
Refseq ID | NP_001265850 |
Protein GI | 525458843 |
UniProt ID | Q9HB55 |
mRNA ID | NM_001278921 |
Length | 393 |
RefSeq Status | REVIEWED |
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRRSLNKIPSWAWWLTPVIPALWEAEAGGSPKVRSSRPALPTWVFGILTENVMKNTEKCGALFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 3, subfamily A, polypeptide 43
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
GO:0070330 | IEA:UniProtKB-EC | F | aromatase activity |
GO:0020037 | IEA:InterPro | F | heme binding |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0004497 | ISS:UniProtKB | F | monooxygenase activity |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
GO:0006805 | TAS:Reactome | P | xenobiotic metabolic process |
KEGG Pathway Links
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_13425 | Miscellaneous substrates |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 3, subfamily A, polypeptide 43
Protein Entry
CP343_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=5; Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q9HB55-1; Sequence=Displayed; Name=2; IsoId=Q9HB55-2; Sequence=VSP_000609; Name=3; IsoId=Q9HB55-3; Sequence=VSP_000610, VSP_000611; Name=4; IsoId=Q9HB55-4; Sequence=VSP_000612, VSP_000613; Note=May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.; Name=7; IsoId=Q9HB55-6; Sequence=VSP_056736; |
Catalytic Activity | RH + reduced flavoprotein + O(2) = ROH + oxidized flavoprotein + H(2)O. |
Cofactor | Name=heme; Xref=ChEBI |
Function | Exhibits low testosterone 6-beta-hydroxylase activity. |
Induction | By rifampicin. |
Miscellaneous | Chimeric transcripts, characterized by CYP3A43 exon 1 joined at canonical splice sites to distinct sets of CYP3A4 or CYP3A5 exons, have been detected. All are possibly produced by trans-splicing. CYP3A43-CYP3A4 chimeric transcripts exist in 3 different combinations: CYP3A43 exon 1 joined in frame to CYP3A4 exons 2-13, CYP3A43 exon 1 joined in frame to CYP3A4 exons 4-13 and CYP3A43 exon 1 joined in frame to CYP3A4 exon 7-13. The longest chimeric isoform (CYP3A43 exon 1 joined to CYP3A4 exons 2- 13) exhibits 6-beta-hydroxylase activity, while a shorter isoform (CYP3A43 exon 1 joined to CYP3A4 exons 4-13) does not. CYP3A43- CYP3A5 chimeric transcripts exist in 2 different combinations: CYP3A43 exon 1 joined in frame to CYP3A5 exon 11-13 and CYP3A43 exon 1 joined in frame to CYP3A5 exon 12-13. All chimeric transcripts are expressed at very low levels in the liver (PubMed:11726664). |
Polymorphism | At protein level, three alleles are known: CYP3A43*1, CYP3A43*2 and CYP3A43*3. The sequence shown is that of CYP3A43*1, which is the most frequent allele. The allele CYP3A43*2 is likely to be non-functional. |
Similarity | Belongs to the cytochrome P450 family. |
Subcellular Location | Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. |
Tissue Specificity | Highest expression level in prostate. Also expressed in liver, kidney, pancreas, fetal liver and fetal skeletal muscle. {ECO |
Web Resource | Name=Cytochrome P450 Allele Nomenclature Committee; Note=CYP3A43 alleles; URL="http://www.cypalleles.ki.se/cyp3a43.htm"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001983 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
12383060 | RefSeq | NP_073731 | 504 | cytochrome P450 3A43 isoform 1 |
16933533 | RefSeq | NP_476436 | 503 | cytochrome P450 3A43 isoform 2 |
16933535 | RefSeq | NP_476437 | 420 | cytochrome P450 3A43 isoform 3 |
525458843 | RefSeq | NP_001265850 | 393 | cytochrome P450 3A43 isoform 4 |
Identical Sequences to LMP001983 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:12383060 | GenBank | AAG33010.1 | 504 | cytochrome P450 subfamily IIIA polypeptide 43 [Homo sapiens] |
GI:16933535 | GenBank | AAG33011.1 | 420 | cytochrome P450 subfamily IIIA polypeptide 43 [Homo sapiens] |
GI:16933533 | GenBank | AAQ92353.1 | 503 | cytochrome P450 CYP3A43.1 [Homo sapiens] |
GI:16933533 | GenBank | AAR76560.1 | 503 | Sequence 2 from patent US 6645745 |
GI:12383060 | GenBank | AAR76561.1 | 504 | Sequence 4 from patent US 6645745 |
GI:16933535 | GenBank | AAR76562.1 | 420 | Sequence 6 from patent US 6645745 |
GI:12383060 | GenBank | AAS07394.1 | 504 | unknown [Homo sapiens] |
GI:16933533 | GenBank | AAS07395.1 | 503 | unknown [Homo sapiens] |
GI:525458843 | GenBank | AAI00982.1 | 393 | CYP3A43 protein [Homo sapiens] |
GI:16933535 | GenBank | EAW76631.1 | 420 | cytochrome P450, family 3, subfamily A, polypeptide 43, isoform CRA_b [Homo sapiens] |
GI:16933533 | GenBank | EAW76632.1 | 503 | cytochrome P450, family 3, subfamily A, polypeptide 43, isoform CRA_c [Homo sapiens] |
GI:12383060 | GenBank | EAW76634.1 | 504 | cytochrome P450, family 3, subfamily A, polypeptide 43, isoform CRA_e [Homo sapiens] |
GI:12383060 | GenBank | AHD77999.1 | 504 | Sequence 24978 from patent US 8586006 |
GI:16933533 | GenBank | AHD78000.1 | 503 | Sequence 24979 from patent US 8586006 |
GI:16933535 | GenBank | AHD78001.1 | 420 | Sequence 24980 from patent US 8586006 |
GI:525458843 | GenBank | AIC60624.1 | 393 | CYP3A43, partial [synthetic construct] |
GI:16933533 | SwissProt | Q9HB55.1 | 503 | RecName: Full=Cytochrome P450 3A43 [Homo sapiens] |
Related Sequences to LMP001983 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16933535 | GenBank | AAG33009.1 | 503 | cytochrome P450 subfamily IIIA polypeptide 43 [Homo sapiens] |
GI:12383060 | GenBank | AAG33009.1 | 503 | cytochrome P450 subfamily IIIA polypeptide 43 [Homo sapiens] |
GI:12383060 | GenBank | AAK00325.1 | 503 | cytochrome P450 CYP3A43 [Homo sapiens] |
GI:16933535 | GenBank | AAK00325.1 | 503 | cytochrome P450 CYP3A43 [Homo sapiens] |
GI:12383060 | GenBank | AAK38841.1 | 503 | cytochrome P450 subfamily IIIA polypeptide 43 [Homo sapiens] |
GI:16933535 | GenBank | AAK38841.1 | 503 | cytochrome P450 subfamily IIIA polypeptide 43 [Homo sapiens] |
GI:16933533 | GenBank | AAQ92352.1 | 503 | cytochrome P450 CYP3A43.3 [Homo sapiens] |
GI:16933533 | GenBank | AAR76561.1 | 504 | Sequence 4 from patent US 6645745 |
GI:16933533 | GenBank | AAS07394.1 | 504 | unknown [Homo sapiens] |
GI:525458843 | GenBank | EAW76632.1 | 503 | cytochrome P450, family 3, subfamily A, polypeptide 43, isoform CRA_c [Homo sapiens] |
GI:16933533 | GenBank | EAW76634.1 | 504 | cytochrome P450, family 3, subfamily A, polypeptide 43, isoform CRA_e [Homo sapiens] |
GI:16933533 | GenBank | AHD77999.1 | 504 | Sequence 24978 from patent US 8586006 |
GI:12383060 | GenBank | AHD78000.1 | 503 | Sequence 24979 from patent US 8586006 |
GI:16933535 | GenBank | AHD78000.1 | 503 | Sequence 24979 from patent US 8586006 |
GI:16933533 | RefSeq | NP_073731.1 | 504 | cytochrome P450 3A43 isoform 1 [Homo sapiens] |
GI:12383060 | RefSeq | NP_476436.1 | 503 | cytochrome P450 3A43 isoform 2 [Homo sapiens] |
GI:16933535 | RefSeq | NP_476436.1 | 503 | cytochrome P450 3A43 isoform 2 [Homo sapiens] |
GI:525458843 | RefSeq | XP_005549229.1 | 393 | PREDICTED: cytochrome P450 3A43-like isoform X3 [Macaca fascicularis] |
GI:525458843 | RefSeq | XP_008966992.1 | 453 | PREDICTED: cytochrome P450 3A43 isoform X5 [Pan paniscus] |
GI:525458843 | RefSeq | XP_009200929.1 | 393 | PREDICTED: cytochrome P450 3A43-like [Papio anubis] |
GI:525458843 | RefSeq | XP_009240872.1 | 393 | PREDICTED: cytochrome P450 3A43 isoform X4 [Pongo abelii] |
GI:525458843 | RefSeq | XP_009452013.1 | 491 | PREDICTED: cytochrome P450 3A43 isoform X5 [Pan troglodytes] |
GI:12383060 | SwissProt | Q9HB55.1 | 503 | RecName: Full=Cytochrome P450 3A43 [Homo sapiens] |
GI:16933535 | SwissProt | Q9HB55.1 | 503 | RecName: Full=Cytochrome P450 3A43 [Homo sapiens] |