Gene/Proteome Database (LMPD)
LMPD ID
LMP001999
Gene ID
Species
Homo sapiens (Human)
Gene Name
prostaglandin E receptor 2 (subtype EP2), 53kDa
Gene Symbol
Synonyms
EP2
Alternate Names
prostaglandin E2 receptor EP2 subtype; prostanoid EP2 receptor; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; prostaglandin E receptor 2 (subtype EP2), 53kD
Chromosome
14
Map Location
14q22
Summary
This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma. [provided by RefSeq, Oct 2009]
Orthologs
Proteins
prostaglandin E2 receptor EP2 subtype | |
---|---|
Refseq ID | NP_000947 |
Protein GI | 31881630 |
UniProt ID | P43116 |
mRNA ID | NM_000956 |
Length | 358 |
RefSeq Status | REVIEWED |
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL |
Gene Information
Entrez Gene ID
Gene Name
prostaglandin E receptor 2 (subtype EP2), 53kDa
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005887 | TAS:ProtInc | C | integral component of plasma membrane |
GO:0005886 | TAS:Reactome | C | plasma membrane |
GO:0004957 | TAS:ProtInc | F | prostaglandin E receptor activity |
GO:0007189 | ISS:BHF-UCL | P | adenylate cyclase-activating G-protein coupled receptor signaling pathway |
GO:0071380 | ISS:BHF-UCL | P | cellular response to prostaglandin E stimulus |
GO:0007186 | TAS:ProtInc | P | G-protein coupled receptor signaling pathway |
GO:0042127 | IEA:Ensembl | P | regulation of cell proliferation |
GO:0032496 | IEA:Ensembl | P | response to lipopolysaccharide |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin E receptor 2 (subtype EP2), 53kDa
Protein Entry
PE2R2_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Function | Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle. |
Similarity | Belongs to the G-protein coupled receptor 1 family. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Tissue Specificity | Placenta and lung. |
Web Resource | Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/ptger2/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001999 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
31881630 | RefSeq | NP_000947 | 358 | prostaglandin E2 receptor EP2 subtype |
Identical Sequences to LMP001999 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31881630 | GenBank | AAH93929.1 | 358 | Prostaglandin E receptor 2 (subtype EP2), 53kDa [Homo sapiens] |
GI:31881630 | GenBank | ABA09888.1 | 358 | Sequence 4 from patent US 6911531 |
GI:31881630 | GenBank | ABD48958.1 | 358 | prostaglandin E receptor 2 (subtype EP2), 53kDa [Homo sapiens] |
GI:31881630 | GenBank | EAW65652.1 | 358 | prostaglandin E receptor 2 (subtype EP2), 53kDa, isoform CRA_a [Homo sapiens] |
GI:31881630 | GenBank | EAW65654.1 | 358 | prostaglandin E receptor 2 (subtype EP2), 53kDa, isoform CRA_a [Homo sapiens] |
GI:31881630 | GenBank | AHD75951.1 | 358 | Sequence 18334 from patent US 8586006 |
Related Sequences to LMP001999 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31881630 | GenBank | AAD44177.1 | 358 | prostaglandin E2 receptor EP2 subtype [Homo sapiens] |
GI:31881630 | GenBank | JAA04794.1 | 358 | prostaglandin E receptor 2 (subtype EP2), 53kDa [Pan troglodytes] |
GI:31881630 | GenBank | JAA14480.1 | 358 | prostaglandin E receptor 2 (subtype EP2), 53kDa [Pan troglodytes] |
GI:31881630 | GenBank | JAA26236.1 | 358 | prostaglandin E receptor 2 (subtype EP2), 53kDa [Pan troglodytes] |
GI:31881630 | GenBank | JAA40580.1 | 358 | prostaglandin E receptor 2 (subtype EP2), 53kDa [Pan troglodytes] |
GI:31881630 | RefSeq | XP_003831760.1 | 358 | PREDICTED: prostaglandin E2 receptor EP2 subtype [Pan paniscus] |