Gene/Proteome Database (LMPD)

LMPD ID
LMP001999
Gene ID
5732
Species
Homo sapiens (Human)
Gene Name
prostaglandin E receptor 2 (subtype EP2), 53kDa
Gene Symbol
PTGER2
Synonyms
EP2
Alternate Names
prostaglandin E2 receptor EP2 subtype; prostanoid EP2 receptor; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; prostaglandin E receptor 2 (subtype EP2), 53kD
Chromosome
14
Map Location
14q22
Summary
This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma. [provided by RefSeq, Oct 2009]
Orthologs
View orthologs and multiple alignments for PTGER2

Proteins

prostaglandin E2 receptor EP2 subtype
Refseq ID NP_000947
Protein GI 31881630
UniProt ID P43116
mRNA ID NM_000956
Length 358
RefSeq Status REVIEWED
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL

Gene Information

Entrez Gene ID
5732
Gene Name
prostaglandin E receptor 2 (subtype EP2), 53kDa
Gene Symbol
PTGER2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 TAS:ProtInc C integral component of plasma membrane
GO:0005886 TAS:Reactome C plasma membrane
GO:0004957 TAS:ProtInc F prostaglandin E receptor activity
GO:0007186 TAS:ProtInc P G-protein coupled receptor signaling pathway
GO:0007189 ISS:BHF-UCL P adenylate cyclase-activating G-protein coupled receptor signaling pathway
GO:0071380 ISS:BHF-UCL P cellular response to prostaglandin E stimulus
GO:0042127 IEA:Ensembl P regulation of cell proliferation
GO:0032496 IEA:Ensembl P response to lipopolysaccharide

KEGG Pathway Links

KEGG Pathway ID Description
hsa04750 Inflammatory mediator regulation of TRP channels
hsa04024 cAMP signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR001923 Prostanoid EP2 receptor
IPR008365 Prostanoid receptor

UniProt Annotations

Entry Information

Gene Name
prostaglandin E receptor 2 (subtype EP2), 53kDa
Protein Entry
PE2R2_HUMAN
UniProt ID
P43116
Species
Human

Comments

Comment Type Description
Function Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle.
Similarity Belongs to the G-protein coupled receptor 1 family.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Tissue Specificity Placenta and lung.
Web Resource Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/ptger2/";

Identical and Related Proteins

Unique RefSeq proteins for LMP001999 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
31881630 RefSeq NP_000947 358 prostaglandin E2 receptor EP2 subtype

Identical Sequences to LMP001999 proteins

Reference Database Accession Length Protein Name
GI:31881630 GenBank AAH93929.1 358 Prostaglandin E receptor 2 (subtype EP2), 53kDa [Homo sapiens]
GI:31881630 GenBank ABA09888.1 358 Sequence 4 from patent US 6911531
GI:31881630 GenBank ABD48958.1 358 prostaglandin E receptor 2 (subtype EP2), 53kDa [Homo sapiens]
GI:31881630 GenBank EAW65652.1 358 prostaglandin E receptor 2 (subtype EP2), 53kDa, isoform CRA_a [Homo sapiens]
GI:31881630 GenBank EAW65654.1 358 prostaglandin E receptor 2 (subtype EP2), 53kDa, isoform CRA_a [Homo sapiens]
GI:31881630 GenBank AHD75951.1 358 Sequence 18334 from patent US 8586006

Related Sequences to LMP001999 proteins

Reference Database Accession Length Protein Name
GI:31881630 GenBank AAD44177.1 358 prostaglandin E2 receptor EP2 subtype [Homo sapiens]
GI:31881630 GenBank JAA04794.1 358 prostaglandin E receptor 2 (subtype EP2), 53kDa [Pan troglodytes]
GI:31881630 GenBank JAA14480.1 358 prostaglandin E receptor 2 (subtype EP2), 53kDa [Pan troglodytes]
GI:31881630 GenBank JAA26236.1 358 prostaglandin E receptor 2 (subtype EP2), 53kDa [Pan troglodytes]
GI:31881630 GenBank JAA40580.1 358 prostaglandin E receptor 2 (subtype EP2), 53kDa [Pan troglodytes]
GI:31881630 RefSeq XP_003831760.1 358 PREDICTED: prostaglandin E2 receptor EP2 subtype [Pan paniscus]