Gene/Proteome Database (LMPD)

LMPD ID
LMP002012
Gene ID
10317
Species
Homo sapiens (Human)
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
B3GALT5
Synonyms
B3GalT-V; B3GalTx; B3T5; GLCT5; beta-1,3-GalTase 5; beta-3-Gx-T5; beta3Gal-T5
Alternate Names
beta-1,3-galactosyltransferase 5; beta-3-galactosyltransferase 5; homolog of C. elegans Bt toxin resistance gene bre-5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5
Chromosome
21
Map Location
21q22.3
EC Number
2.4.1.-
Summary
This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants have been observed for this gene, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2013]
Orthologs
View orthologs and multiple alignments for B3GALT5

Proteins

beta-1,3-galactosyltransferase 5 isoform a
Refseq ID NP_149360
Protein GI 15451881
UniProt ID Q9Y2C3
mRNA ID NM_033170
Length 310
RefSeq Status REVIEWED
MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV
beta-1,3-galactosyltransferase 5 isoform a
Refseq ID NP_001265579
Protein GI 520975380
UniProt ID Q9Y2C3
mRNA ID NM_001278650
Length 310
RefSeq Status REVIEWED
Protein sequence is identical to GI:15451881 (mRNA isoform)
beta-1,3-galactosyltransferase 5 isoform a
Refseq ID NP_006048
Protein GI 5174397
UniProt ID Q9Y2C3
mRNA ID NM_006057
Length 310
RefSeq Status REVIEWED
Protein sequence is identical to GI:15451881 (mRNA isoform)
beta-1,3-galactosyltransferase 5 isoform a
Refseq ID NP_149361
Protein GI 15451883
UniProt ID Q9Y2C3
mRNA ID NM_033171
Length 310
RefSeq Status REVIEWED
Protein sequence is identical to GI:15451881 (mRNA isoform)
beta-1,3-galactosyltransferase 5 isoform b
Refseq ID NP_149362
Protein GI 15451883
UniProt ID Q9Y2C3
mRNA ID NM_033172
Length 310
RefSeq Status REVIEWED
Protein sequence is identical to GI:15451881 (mRNA isoform)

Gene Information

Entrez Gene ID
10317
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
B3GALT5
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:UniProtKB C Golgi apparatus
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008499 TAS:ProtInc F UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0006486 TAS:ProtInc P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
hsa00603 Glycosphingolipid biosynthesis - globo series
hsa00601 Glycosphingolipid biosynthesis - lacto and neolacto series
hsa01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002659 Glycosyl transferase, family 31

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Protein Entry
B3GT5_HUMAN
UniProt ID
Q9Y2C3
Species
Human

Comments

Comment Type Description
Function Catalyzes the transfer of Gal to GlcNAc-based acceptors with a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Can use glycolipid LC3Cer as an efficient acceptor.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 31 family.
Subcellular Location Golgi apparatus membrane ; Single-pass type II membrane protein .
Tissue Specificity Expressed in stomach, jejunum, colon, pancreas, small intestine, testis and gastrointestinal and pancreatic cancer cell lines. Hardly detected in lung, liver, adrenal gland and peripheral blood leukocytes.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=Beta-1,3-galactosyltransferase 5; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_432";
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=B3GALT5";

Identical and Related Proteins

Unique RefSeq proteins for LMP002012 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15451881 RefSeq NP_149360 310 beta-1,3-galactosyltransferase 5 isoform a

Identical Sequences to LMP002012 proteins

Reference Database Accession Length Protein Name
GI:15451881 GenBank AAR08910.1 310 beta-1,3-galactosyltransferase 5 [Homo sapiens]
GI:15451881 GenBank ABU33730.1 310 Sequence 1 from patent US 7241605
GI:15451881 RefSeq NP_149361.1 310 beta-1,3-galactosyltransferase 5 isoform a [Homo sapiens]
GI:15451881 RefSeq NP_001265579.1 310 beta-1,3-galactosyltransferase 5 isoform a [Homo sapiens]
GI:15451881 RefSeq XP_005260969.1 310 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Homo sapiens]
GI:15451881 SwissProt Q9Y2C3.1 310 RecName: Full=Beta-1,3-galactosyltransferase 5; Short=Beta-1,3-GalTase 5; Short=Beta3Gal-T5; Short=Beta3GalT5; Short=b3Gal-T5; AltName: Full=Beta-3-Gx-T5; AltName: Full=UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5; AltName: Full=UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5 [Homo sapiens]

Related Sequences to LMP002012 proteins

Reference Database Accession Length Protein Name
GI:15451881 DBBJ BAF85640.1 310 unnamed protein product [Homo sapiens]
GI:15451881 GenBank EAX09629.1 310 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5, isoform CRA_b [Homo sapiens]
GI:15451881 GenBank EAX09630.1 310 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5, isoform CRA_b [Homo sapiens]
GI:15451881 GenBank ACC03082.1 310 Sequence 9 from patent US 7332279
GI:15451881 GenBank ACM99938.1 310 Sequence 9 from patent US 7476527
GI:15451881 RefSeq NP_149362.2 314 beta-1,3-galactosyltransferase 5 isoform b [Homo sapiens]