Gene/Proteome Database (LMPD)

LMPD ID
LMP002036
Gene ID
11816
Species
Mus musculus (Mouse)
Gene Name
apolipoprotein E
Gene Symbol
Apoe
Synonyms
AI255918
Alternate Names
apolipoprotein E; apo-E
Chromosome
7
Map Location
7 A3|7 9.94 cM

Proteins

apolipoprotein E precursor
Refseq ID NP_033826
Protein GI 163644329
UniProt ID P08226
mRNA ID NM_009696
Length 311
RefSeq Status VALIDATED
MKALWAVLLVTLLTGCLAEGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1916 peptide sequence: MKALWAVLLVTLLTGCLA mat_peptide: 19..311 product: Apolipoprotein E experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P08226.2) calculated_mol_wt: 33968 peptide sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Gene Information

Entrez Gene ID
11816
Gene Name
apolipoprotein E
Gene Symbol
Apoe
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:Ensembl C Golgi apparatus
GO:0072562 IEA:Ensembl C blood microparticle
GO:0042627 IEA:UniProtKB-KW C chylomicron
GO:0005829 TAS:Reactome C cytosol
GO:0030425 IEA:Ensembl C dendrite
GO:0005576 TAS:Reactome C extracellular region
GO:0005615 IDA:MGI C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0031232 IEA:Ensembl C extrinsic component of external side of plasma membrane
GO:0034364 IEA:UniProtKB-KW C high-density lipoprotein particle
GO:0034363 IEA:Ensembl C intermediate-density lipoprotein particle
GO:0005770 IEA:Ensembl C late endosome
GO:0034362 IDA:BHF-UCL C low-density lipoprotein particle
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0005634 IEA:Ensembl C nucleus
GO:0034361 IEA:UniProtKB-KW C very-low-density lipoprotein particle
GO:0016209 IEA:Ensembl F antioxidant activity
GO:0001540 ISS:UniProtKB F beta-amyloid binding
GO:0017127 IDA:MGI F cholesterol transporter activity
GO:0008201 IEA:UniProtKB-KW F heparin binding
GO:0046848 IEA:Ensembl F hydroxyapatite binding
GO:0071813 IDA:MGI F lipoprotein particle binding
GO:0046911 IEA:Ensembl F metal chelating activity
GO:0060228 IMP:BHF-UCL F phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0005543 IEA:Ensembl F phospholipid binding
GO:0007186 IEA:Ensembl P G-protein coupled receptor signaling pathway
GO:0007568 IEA:Ensembl P aging
GO:0048844 IGI:MGI P artery morphogenesis
GO:0019934 IEA:Ensembl P cGMP-mediated signaling
GO:0072358 IMP:MGI P cardiovascular system development
GO:0006874 IDA:MGI P cellular calcium ion homeostasis
GO:0071397 IEA:Ensembl P cellular response to cholesterol
GO:0071363 IEA:Ensembl P cellular response to growth factor stimulus
GO:0071347 IEA:Ensembl P cellular response to interleukin-1
GO:0006707 IMP:MGI P cholesterol catabolic process
GO:0033344 IDA:MGI P cholesterol efflux
GO:0042632 IMP:MGI P cholesterol homeostasis
GO:0008203 IMP:MGI P cholesterol metabolic process
GO:0034382 IEA:Ensembl P chylomicron remnant clearance
GO:0055089 IEA:Ensembl P fatty acid homeostasis
GO:0034380 IEA:Ensembl P high-density lipoprotein particle assembly
GO:0034384 IEA:Ensembl P high-density lipoprotein particle clearance
GO:0034375 IEA:Ensembl P high-density lipoprotein particle remodeling
GO:0055088 IMP:MGI P lipid homeostasis
GO:0006629 IGI:MGI P lipid metabolic process
GO:0042158 IGI:MGI P lipoprotein biosynthetic process
GO:0042159 IMP:MGI P lipoprotein catabolic process
GO:0042157 IMP:MGI P lipoprotein metabolic process
GO:0015909 IEA:Ensembl P long-chain fatty acid transport
GO:0034374 IMP:BHF-UCL P low-density lipoprotein particle remodeling
GO:0051651 IMP:MGI P maintenance of location in cell
GO:0043407 IEA:Ensembl P negative regulation of MAP kinase activity
GO:1902430 IEA:Ensembl P negative regulation of beta-amyloid formation
GO:0043537 IEA:Ensembl P negative regulation of blood vessel endothelial cell migration
GO:0045541 IEA:Ensembl P negative regulation of cholesterol biosynthetic process
GO:0090370 IEA:Ensembl P negative regulation of cholesterol efflux
GO:0061000 IEA:Ensembl P negative regulation of dendritic spine development
GO:1902951 IEA:Ensembl P negative regulation of dendritic spine maintenance
GO:0001937 IEA:Ensembl P negative regulation of endothelial cell proliferation
GO:0050728 IGI:UniProtKB P negative regulation of inflammatory response
GO:1903001 IEA:Ensembl P negative regulation of lipid transport across blood brain barrier
GO:0043524 IEA:Ensembl P negative regulation of neuron apoptotic process
GO:1902999 IEA:Ensembl P negative regulation of phospholipid efflux
GO:0010544 IEA:Ensembl P negative regulation of platelet activation
GO:1901627 IEA:Ensembl P negative regulation of postsynaptic membrane organization
GO:1901630 IEA:Ensembl P negative regulation of presynaptic membrane organization
GO:0007263 IEA:Ensembl P nitric oxide mediated signal transduction
GO:0048709 IEA:Ensembl P oligodendrocyte differentiation
GO:0033700 IEA:Ensembl P phospholipid efflux
GO:0045773 IEA:Ensembl P positive regulation of axon extension
GO:1902004 IEA:Ensembl P positive regulation of beta-amyloid formation
GO:0030828 IEA:Ensembl P positive regulation of cGMP biosynthetic process
GO:0010875 IEA:Ensembl P positive regulation of cholesterol efflux
GO:0010873 IMP:BHF-UCL P positive regulation of cholesterol esterification
GO:0060999 IEA:Ensembl P positive regulation of dendritic spine development
GO:1902952 IEA:Ensembl P positive regulation of dendritic spine maintenance
GO:0046889 IEA:Ensembl P positive regulation of lipid biosynthetic process
GO:1903002 IEA:Ensembl P positive regulation of lipid transport across blood brain barrier
GO:0032805 IEA:Ensembl P positive regulation of low-density lipoprotein particle receptor catabolic process
GO:0051044 IEA:Ensembl P positive regulation of membrane protein ectodomain proteolysis
GO:1902998 IEA:Ensembl P positive regulation of neurofibrillary tangle assembly
GO:1901216 IEA:Ensembl P positive regulation of neuron death
GO:0051000 IEA:Ensembl P positive regulation of nitric-oxide synthase activity
GO:1902995 IEA:Ensembl P positive regulation of phospholipid efflux
GO:1901628 IEA:Ensembl P positive regulation of postsynaptic membrane organization
GO:1901631 IEA:Ensembl P positive regulation of presynaptic membrane organization
GO:0006898 IEA:Ensembl P receptor-mediated endocytosis
GO:0032489 IEA:Ensembl P regulation of Cdc42 protein signal transduction
GO:1900221 IEA:Ensembl P regulation of beta-amyloid clearance
GO:0010468 IMP:MGI P regulation of gene expression
GO:1902947 IEA:Ensembl P regulation of tau-protein kinase activity
GO:0002021 IMP:MGI P response to dietary excess
GO:0045471 IEA:Ensembl P response to ethanol
GO:0032868 IEA:Ensembl P response to insulin
GO:0006979 IMP:MGI P response to oxidative stress
GO:0032526 IEA:Ensembl P response to retinoic acid
GO:0043691 IEA:Ensembl P reverse cholesterol transport
GO:0006641 IEA:Ensembl P triglyceride metabolic process
GO:0042311 IMP:MGI P vasodilation
GO:0034447 IEA:Ensembl P very-low-density lipoprotein particle clearance
GO:0034372 IMP:BHF-UCL P very-low-density lipoprotein particle remodeling

KEGG Pathway Links

KEGG Pathway ID Description
mmu05010 Alzheimer's disease

REACTOME Pathway Links

REACTOME Pathway ID Description
5893389 Chylomicron-mediated lipid transport
5893599 HDL-mediated lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR000074 Apolipoprotein A/E

UniProt Annotations

Entry Information

Gene Name
apolipoprotein E
Protein Entry
APOE_MOUSE
UniProt ID
P08226
Species
Mouse

Comments

Comment Type Description
Disruption Phenotype APOE single knockout mice are atherosclerosis-prone. Animals with a double knockout of APOE and CD36, fed a Western diet for 12 weeks, exhibit much lower levels of CXCL1, CXCL2 and CCL5 mRNA expression in the descending aorta and a corresponding decrease in atherosclerotic lesion formation, compared to APOE single knockout mice. {ECO:0000269|PubMed:20037584}.
Function Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
Ptm Phosphorylation sites are present in the extracellular medium. {ECO:0000250}.
Similarity Belongs to the apolipoprotein A1/A4/E family. {ECO:0000305}.
Subcellular Location Secreted.
Tissue Specificity Secreted in plasma.

Identical and Related Proteins

Unique RefSeq proteins for LMP002036 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
163644329 RefSeq NP_033826 311 apolipoprotein E precursor

Identical Sequences to LMP002036 proteins

Reference Database Accession Length Protein Name
GI:163644329 DBBJ BAE22338.1 311 unnamed protein product [Mus musculus]
GI:163644329 DBBJ BAE34821.1 311 unnamed protein product [Mus musculus]
GI:163644329 DBBJ BAE35147.1 311 unnamed protein product [Mus musculus]
GI:163644329 GenBank AAH83351.1 311 Apolipoprotein E [Mus musculus]
GI:163644329 GenBank EDL23183.1 311 apolipoprotein E, isoform CRA_h [Mus musculus]
GI:163644329 GenBank EDL23184.1 311 apolipoprotein E, isoform CRA_h [Mus musculus]

Related Sequences to LMP002036 proteins

Reference Database Accession Length Protein Name
GI:163644329 DBBJ BAE28964.1 311 unnamed protein product [Mus musculus]
GI:163644329 EMBL CAJ18564.1 311 Apoe [Mus musculus]
GI:163644329 GenBank AAA37251.1 311 apolipoprotein E precursor [Mus musculus]
GI:163644329 GenBank AAH28816.1 311 Apolipoprotein E [Mus musculus]
GI:163644329 GenBank ADF19222.1 311 Sequence 94 from patent US 7670787
GI:163644329 RefSeq XP_006539547.1 355 PREDICTED: apolipoprotein E isoform X1 [Mus musculus]