Gene/Proteome Database (LMPD)
LMPD ID
LMP002052
Gene ID
Species
Homo sapiens (Human)
Gene Name
fatty acid binding protein 6, ileal
Gene Symbol
Synonyms
I-15P; I-BABP; I-BALB; I-BAP; ILBP; ILBP3; ILLBP
Alternate Names
gastrotropin; GT; intestinal 15 kDa protein; ileal lipid-binding protein; illeal lipid-binding protein; ileal bile acid binding protein
Chromosome
5
Map Location
5q33.3-q34
Summary
This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| gastrotropin isoform 1 | |
|---|---|
| Refseq ID | NP_001124430 |
| Protein GI | 195972864 |
| UniProt ID | P51161 |
| mRNA ID | NM_001130958 |
| Length | 177 |
| RefSeq Status | REVIEWED |
| MKTVTMMMVVEMQALTQVLRAVLSACTWVSRKGDLQRMKQTHKGKPPSSMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA | |
| gastrotropin isoform 1 | |
|---|---|
| Refseq ID | NP_001035532 |
| Protein GI | 94721243 |
| UniProt ID | P51161 |
| mRNA ID | NM_001040442 |
| Length | 177 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:195972864 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
fatty acid binding protein 6, ileal
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | TAS:ProtInc | C | cytoplasm |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0008289 | TAS:ProtInc | F | lipid binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
| GO:0015721 | TAS:Reactome | P | bile acid and bile salt transport |
| GO:0008206 | TAS:Reactome | P | bile acid metabolic process |
| GO:0006629 | NAS:ProtInc | P | lipid metabolic process |
| GO:0008285 | TAS:ProtInc | P | negative regulation of cell proliferation |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_11040 | Bile acid and bile salt metabolism |
| REACT_11042 | Recycling of bile acids and salts |
Domain Information
UniProt Annotations
Entry Information
Gene Name
fatty acid binding protein 6, ileal
Protein Entry
FABP6_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative promoter usage; Named isoforms=2; Name=1; IsoId=P51161-1; Sequence=Displayed; Name=2; Synonyms=IBABP-L; IsoId=P51161-2; Sequence=VSP_038039; |
| Domain | Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior. |
| Function | Ileal protein which stimulates gastric acid and pepsinogen secretion. Seems to be able to bind to bile salts and bilirubins. Isoform 2 is essential for the survival of colon cancer cells to bile acid-induced apoptosis. |
| Induction | Isoform 1 is up-regulated by chenodeoxycholic acid (CDCA) via the FXR transcription pathway. Isoform 2 is up- regulated by NF-kappa-B and in all stages of colorectal adenocarcinoma. Isoform 1 is not up-regulated in all stages of colorectal adenocarcinoma. |
| Sequence Caution | Sequence=AAH22489.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Subcellular Location | Isoform 1: Cytoplasm. |
| Subcellular Location | Isoform 2: Cytoplasm. Note=Localized close to nucleus on the apical side of both normal and neoplastic cells. |
| Tissue Specificity | Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level). Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is expressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002052 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 195972864 | RefSeq | NP_001124430 | 177 | gastrotropin isoform 1 |
| 4557583 | RefSeq | NP_001436 | 128 | gastrotropin isoform 2 |
Identical Sequences to LMP002052 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:195972864 | DBBJ | BAI46829.1 | 177 | fatty acid binding protein 6, ileal, partial [synthetic construct] |
| GI:195972864 | GenBank | ABA12611.1 | 177 | ileal bile acid binding protein long isoform [Homo sapiens] |
| GI:4557583 | GenBank | AHD28556.1 | 128 | Sequence 8 from patent US 8563248 |
| GI:195972864 | GenBank | AHD28557.1 | 177 | Sequence 9 from patent US 8563248 |
| GI:4557583 | GenBank | AHE02231.1 | 128 | Sequence 60585 from patent US 8586006 |
| GI:195972864 | RefSeq | NP_001035532.1 | 177 | gastrotropin isoform 1 [Homo sapiens] |
| GI:4557583 | RefSeq | XP_003268650.1 | 128 | PREDICTED: gastrotropin isoform 2 [Nomascus leucogenys] |
| GI:4557583 | RefSeq | XP_004042976.1 | 128 | PREDICTED: gastrotropin isoform 3 [Gorilla gorilla gorilla] |
| GI:195972864 | RefSeq | XP_006714891.1 | 177 | PREDICTED: gastrotropin isoform X1 [Homo sapiens] |
| GI:4557583 | RefSeq | XP_006714893.1 | 128 | PREDICTED: gastrotropin isoform X3 [Homo sapiens] |
| GI:4557583 | SwissProt | P51161.2 | 128 | RecName: Full=Gastrotropin; Short=GT; AltName: Full=Fatty acid-binding protein 6; AltName: Full=Ileal lipid-binding protein; Short=ILBP; AltName: Full=Intestinal 15 kDa protein; Short=I-15P; AltName: Full=Intestinal bile acid-binding protein; Short=I-BABP [Homo sapiens] |
Related Sequences to LMP002052 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4557583 | DBBJ | BAI46829.1 | 177 | fatty acid binding protein 6, ileal, partial [synthetic construct] |
| GI:4557583 | GenBank | ABA12611.1 | 177 | ileal bile acid binding protein long isoform [Homo sapiens] |
| GI:195972864 | GenBank | EAW61564.1 | 177 | fatty acid binding protein 6, ileal (gastrotropin), isoform CRA_b [Homo sapiens] |
| GI:195972864 | GenBank | EAW61566.1 | 248 | fatty acid binding protein 6, ileal (gastrotropin), isoform CRA_d, partial [Homo sapiens] |
| GI:195972864 | GenBank | EHH26995.1 | 177 | hypothetical protein EGK_17089 [Macaca mulatta] |
| GI:195972864 | GenBank | EHH54723.1 | 177 | hypothetical protein EGM_15615 [Macaca fascicularis] |
| GI:195972864 | GenBank | AHD28555.1 | 176 | Sequence 7 from patent US 8563248 |
| GI:4557583 | GenBank | AHD28557.1 | 177 | Sequence 9 from patent US 8563248 |
| GI:4557583 | RefSeq | NP_001035532.1 | 177 | gastrotropin isoform 1 [Homo sapiens] |
| GI:4557583 | RefSeq | NP_001124430.1 | 177 | gastrotropin isoform 1 [Homo sapiens] |
| GI:195972864 | RefSeq | XP_003268649.1 | 177 | PREDICTED: gastrotropin isoform 1 [Nomascus leucogenys] |
| GI:4557583 | RefSeq | XP_006714891.1 | 177 | PREDICTED: gastrotropin isoform X1 [Homo sapiens] |