Gene/Proteome Database (LMPD)

LMPD ID
LMP002064
Gene ID
Species
Homo sapiens (Human)
Gene Name
prostaglandin E synthase
Gene Symbol
Synonyms
MGST-IV; MGST1-L1; MGST1L1; MPGES; PGES; PIG12; PP102; PP1294; TP53I12; mPGES-1
Alternate Names
prostaglandin E synthase; MGST1-like 1; p53-induced gene 12 protein; p53-induced apoptosis protein 12; glutathione S-transferase 1-like 1; microsomal prostaglandin E synthase 1; microsomal prostaglandin E synthase-1; tumor protein p53 inducible protein 12; microsomal glutathione S-transferase 1-like 1
Chromosome
9
Map Location
9q34.3
EC Number
5.3.99.3
Summary
The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

prostaglandin E synthase
Refseq ID NP_004869
Protein GI 4758910
UniProt ID O14684
mRNA ID NM_004878
Length 152
RefSeq Status REVIEWED
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

Gene Information

Entrez Gene ID
Gene Name
prostaglandin E synthase
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IDA:UniProtKB C integral component of membrane
GO:0016020 TAS:ProtInc C membrane
GO:0005641 IEA:Ensembl C nuclear envelope lumen
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0043295 IDA:UniProtKB F glutathione binding
GO:0050220 IDA:UniProtKB F prostaglandin-E synthase activity
GO:0002526 IEA:Ensembl P acute inflammatory response
GO:0019369 TAS:Reactome P arachidonic acid metabolic process
GO:0002544 IEA:Ensembl P chronic inflammatory response
GO:0019371 TAS:Reactome P cyclooxygenase pathway
GO:0008285 IEA:Ensembl P negative regulation of cell proliferation
GO:0001516 IDA:UniProtKB P prostaglandin biosynthetic process
GO:0006693 TAS:ProtInc P prostaglandin metabolic process
GO:0051592 IEA:Ensembl P response to calcium ion
GO:0034097 IEA:Ensembl P response to cytokine
GO:0032496 IEA:Ensembl P response to lipopolysaccharide
GO:0014070 IEA:Ensembl P response to organic cyclic compound
GO:0032526 IEA:Ensembl P response to retinoic acid
GO:0007165 NAS:ProtInc P signal transduction
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00590 Arachidonic acid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_147851 Arachidonic acid metabolism
REACT_150149 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
prostaglandin E synthase
Protein Entry
PTGES_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15- dihydroxy-9-oxoprosta-5,13-dienoate.
Cofactor Name=glutathione; Xref=ChEBI
Function Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2).
Induction By p53/TP53.
Similarity Belongs to the MAPEG family.
Subcellular Location Membrane ; Multi-pass membrane protein .
Subunit Homotrimer.

Identical and Related Proteins

Unique RefSeq proteins for LMP002064 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4758910 RefSeq NP_004869 152 prostaglandin E synthase

Identical Sequences to LMP002064 proteins

Reference Database Accession Length Protein Name
GI:4758910 DBBJ BAJ20911.1 152 prostaglandin E synthase, partial [synthetic construct]
GI:4758910 GenBank ADT42240.1 152 Sequence 1186 from patent US 7833706
GI:4758910 GenBank AGY15585.1 152 Sequence 6 from patent US 8546077
GI:4758910 GenBank AIC50381.1 152 PTGES, partial [synthetic construct]
GI:4758910 PDB 4AL0 152 Chain A, Crystal Structure Of Human Ps-1
GI:4758910 PDB 4AL1 152 Chain A, Crystal Structure Of Human Ps-1 Gsh-analog Complex

Related Sequences to LMP002064 proteins

Reference Database Accession Length Protein Name
GI:4758910 GenBank EAW87902.1 180 hCG30600, isoform CRA_a [Homo sapiens]
GI:4758910 GenBank EAW87904.1 180 hCG30600, isoform CRA_a [Homo sapiens]
GI:4758910 GenBank ADT42235.1 180 Sequence 1181 from patent US 7833706
GI:4758910 GenBank ADT42236.1 180 Sequence 1182 from patent US 7833706
GI:4758910 GenBank AFH34732.1 152 prostaglandin E synthase [Macaca mulatta]
GI:4758910 RefSeq XP_003822411.1 152 PREDICTED: prostaglandin E synthase [Pan paniscus]