Gene/Proteome Database (LMPD)
Proteins
cytochrome P450 11B2, mitochondrial | |
---|---|
Refseq ID | NP_034121 |
Protein GI | 226823208 |
UniProt ID | P15539 |
mRNA ID | NM_009991 |
Length | 502 |
RefSeq Status | VALIDATED |
MAMALRVTADVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQYSRNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSVGKTQIVSVMLPEDAEKLHQVESMLPRRMHLEPWVAHRELRGLRRGVFLLNGPEWRLNRLRLNRNVLSPKAVQKFVPMVDMVARDFLETLKEKVLQNARGSLTMDVQQSLFNYTIEASNFALFGERLGLLGHDLSPGSLKFIHALHSMFKSTSQLLFLPKSLTRWTSTRVWKEHFDAWDVISEYANRCIWKVHQELRLGSSQTYSGIVAELISQGSLPLDAIKANSMELTAGSVDTTAIPLVMTLFELARNPDVQKALRQESLAAEASIAANPQKAMSDLPLLRAALKETLRLYPVGGFLERILSSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMMLLLHHILKTFQVETLRQEDVQMAYRFVLMPSSSPVLTFRPVS |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 11, subfamily b, polypeptide 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0020037 | IEA:InterPro | F | heme binding |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0004507 | IDA:MGI | F | steroid 11-beta-monooxygenase activity |
GO:0032342 | IDA:MGI | P | aldosterone biosynthetic process |
GO:0042756 | IMP:MGI | P | drinking behavior |
GO:0050801 | IMP:MGI | P | ion homeostasis |
GO:0002017 | IMP:MGI | P | regulation of blood volume by renal aldosterone |
GO:0001991 | IMP:MGI | P | regulation of systemic arterial blood pressure by circulatory renin-angiotensin |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 11, subfamily b, polypeptide 2
Protein Entry
C11B2_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP002089 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
226823208 | RefSeq | NP_034121 | 502 | cytochrome P450 11B2, mitochondrial |
Identical Sequences to LMP002089 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226823208 | GenBank | EDL29457.1 | 502 | mCG2779, isoform CRA_b [Mus musculus] |
Related Sequences to LMP002089 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226823208 | GenBank | AAB21517.2 | 500 | aldosterone synthase [Mus sp.] |
GI:226823208 | GenBank | AAI16909.1 | 500 | Cytochrome P450, family 11, subfamily b, polypeptide 2 [Mus musculus] |
GI:226823208 | GenBank | AAI19322.1 | 500 | Cytochrome P450, family 11, subfamily b, polypeptide 2 [Mus musculus] |
GI:226823208 | GenBank | EDM16079.1 | 502 | rCG59633 [Rattus norvegicus] |
GI:226823208 | RefSeq | NP_036670.2 | 502 | cytochrome P450 11B2, mitochondrial [Rattus norvegicus] |
GI:226823208 | SwissProt | P15539.3 | 500 | RecName: Full=Cytochrome P450 11B2, mitochondrial; AltName: Full=Aldosterone synthase; AltName: Full=CYPXIB2; AltName: Full=Cytochrome P450C11; AltName: Full=Steroid 11-beta-hydroxylase; Flags: Precursor [Mus musculus] |