Gene/Proteome Database (LMPD)

LMPD ID
LMP002127
Gene ID
5281
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Gene Symbol
PIGF
Synonyms
-
Alternate Names
phosphatidylinositol-glycan biosynthesis class F protein; PIG-F; GPI11 homolog
Chromosome
2
Map Location
2p21-p16
Summary
This gene encodes a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for PIGF

Proteins

phosphatidylinositol-glycan biosynthesis class F protein isoform 1
Refseq ID NP_002634
Protein GI 4505797
UniProt ID Q07326
mRNA ID NM_002643
Length 219
RefSeq Status REVIEWED
MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYLVVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN
phosphatidylinositol-glycan biosynthesis class F protein isoform 2
Refseq ID NP_775097
Protein GI 27894291
UniProt ID Q07326
mRNA ID NM_173074
Length 206
RefSeq Status REVIEWED
MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYLVVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERPWQMTVERKRSTYRSLHVPCRGLGTVK

Gene Information

Entrez Gene ID
5281
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Gene Symbol
PIGF
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 ISS:UniProtKB C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0004307 TAS:ProtInc F ethanolaminephosphotransferase activity
GO:0006501 TAS:Reactome P C-terminal protein lipidation
GO:0006506 ISS:UniProtKB P GPI anchor biosynthetic process
GO:0044267 TAS:Reactome P cellular protein metabolic process
GO:0043687 TAS:Reactome P post-translational protein modification
GO:0016254 TAS:Reactome P preassembly of GPI anchor in ER membrane

KEGG Pathway Links

KEGG Pathway ID Description
hsa00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_952 Synthesis of glycosylphosphatidylinositol (GPI)

Domain Information

InterPro Annotations

Accession Description
IPR009580 GPI biosynthesis protein Pig-F

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Protein Entry
PIGF_HUMAN
UniProt ID
Q07326
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q07326-1; Sequence=Displayed; Name=2; IsoId=Q07326-2; Sequence=VSP_004361; Note=No experimental confirmation available.;
Function Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI.
Pathway Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis.
Similarity Belongs to the PIGF family.
Subcellular Location Endoplasmic reticulum membrane {ECO
Subunit Forms a complex with PIGG and PIGO. PIGF is required to stabilize PIGG and PIGO.

Identical and Related Proteins

Unique RefSeq proteins for LMP002127 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4505797 RefSeq NP_002634 219 phosphatidylinositol-glycan biosynthesis class F protein isoform 1
27894291 RefSeq NP_775097 206 phosphatidylinositol-glycan biosynthesis class F protein isoform 2

Identical Sequences to LMP002127 proteins

Reference Database Accession Length Protein Name
GI:27894291 GenBank AAH21725.1 206 Phosphatidylinositol glycan anchor biosynthesis, class F [Homo sapiens]
GI:4505797 GenBank AAY14835.1 219 unknown [Homo sapiens]
GI:27894291 GenBank EAX00240.1 206 phosphatidylinositol glycan, class F, isoform CRA_a [Homo sapiens]
GI:4505797 GenBank EAX00242.1 219 phosphatidylinositol glycan, class F, isoform CRA_c [Homo sapiens]
GI:4505797 GenBank ABM83564.1 219 phosphatidylinositol glycan anchor biosynthesis, class F [synthetic construct]
GI:4505797 GenBank ABM86802.1 219 phosphatidylinositol glycan anchor biosynthesis, class F, partial [synthetic construct]
GI:4505797 GenBank AHD71809.1 219 Sequence 6503 from patent US 8586006
GI:27894291 GenBank AHD71810.1 206 Sequence 6504 from patent US 8586006
GI:4505797 GenBank AIC49392.1 219 PIGF, partial [synthetic construct]
GI:27894291 GenBank AIC54901.1 206 PIGF, partial [synthetic construct]

Related Sequences to LMP002127 proteins

Reference Database Accession Length Protein Name
GI:4505797 DBBJ BAF83797.1 219 unnamed protein product [Homo sapiens]
GI:27894291 GenBank EAX00241.1 231 phosphatidylinositol glycan, class F, isoform CRA_b [Homo sapiens]
GI:4505797 GenBank EAX00243.1 244 phosphatidylinositol glycan, class F, isoform CRA_d [Homo sapiens]
GI:27894291 GenBank EAX00244.1 187 phosphatidylinositol glycan, class F, isoform CRA_e [Homo sapiens]
GI:4505797 GenBank ACM85983.1 226 Sequence 11481 from patent US 6812339
GI:4505797 RefSeq XP_001147889.1 219 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X1 [Pan troglodytes]
GI:27894291 RefSeq XP_001147744.2 206 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X2 [Pan troglodytes]
GI:4505797 RefSeq XP_004029226.1 219 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform 1 [Gorilla gorilla gorilla]
GI:27894291 RefSeq XP_004029227.1 205 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform 2 [Gorilla gorilla gorilla]
GI:27894291 RefSeq XP_005576021.1 209 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X2 [Macaca fascicularis]
GI:4505797 RefSeq XP_008974491.1 219 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X1 [Pan paniscus]
GI:27894291 RefSeq XP_008974492.1 206 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X2 [Pan paniscus]