Gene/Proteome Database (LMPD)
LMPD ID
LMP002152
Gene ID
Species
Homo sapiens (Human)
Gene Name
aldo-keto reductase family 1, member C1
Gene Symbol
Synonyms
2-ALPHA-HSD; 20-ALPHA-HSD; C9; DD1; DD1/DD2; DDH; DDH1; H-37; HAKRC; HBAB; MBAB
Alternate Names
aldo-keto reductase family 1 member C1; aldo-keto reductase C; indanol dehydrogenase; dihydrodiol dehydrogenase 1; dihydrodiol dehydrogenase 1/2; hepatic dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRC; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-hydroxysteroid dehydrogenase; dihydrodiol dehydrogenase isoform DD1; type II 3-alpha-hydroxysteroid dehydrogenase; high-affinity hepatic bile acid-binding protein; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase
Chromosome
10
Map Location
10p15-p14
EC Number
1.1.1.-
Summary
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| aldo-keto reductase family 1 member C1 | |
|---|---|
| Refseq ID | NP_001344 |
| Protein GI | 5453543 |
| UniProt ID | Q04828 |
| mRNA ID | NM_001353 |
| Length | 323 |
| RefSeq Status | REVIEWED |
| MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY | |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member C1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:UniProtKB | C | cytosol |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0047006 | IEA:UniProtKB-EC | F | 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity |
| GO:0004032 | IDA:UniProtKB | F | alditol:NADP+ 1-oxidoreductase activity |
| GO:0004033 | TAS:UniProtKB | F | aldo-keto reductase (NADP) activity |
| GO:0047042 | IDA:UniProtKB | F | androsterone dehydrogenase (B-specific) activity |
| GO:0032052 | IDA:UniProtKB | F | bile acid binding |
| GO:0031406 | IDA:UniProtKB | F | carboxylic acid binding |
| GO:0047718 | IEA:UniProtKB-EC | F | indanol dehydrogenase activity |
| GO:0047086 | IDA:UniProtKB | F | ketosteroid monooxygenase activity |
| GO:0016655 | IDA:UniProtKB | F | oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor |
| GO:0018636 | IDA:UniProtKB | F | phenanthrene 9,10-monooxygenase activity |
| GO:0047115 | IDA:UniProtKB | F | trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity |
| GO:0015721 | TAS:UniProtKB | P | bile acid and bile salt transport |
| GO:0008206 | IDA:UniProtKB | P | bile acid metabolic process |
| GO:0071395 | IDA:UniProtKB | P | cellular response to jasmonic acid stimulus |
| GO:0042632 | TAS:UniProtKB | P | cholesterol homeostasis |
| GO:0044597 | IMP:UniProtKB | P | daunorubicin metabolic process |
| GO:0007586 | IDA:UniProtKB | P | digestion |
| GO:0044598 | IMP:UniProtKB | P | doxorubicin metabolic process |
| GO:0030855 | IDA:UniProt | P | epithelial cell differentiation |
| GO:0030299 | TAS:UniProtKB | P | intestinal cholesterol absorption |
| GO:0055114 | IDA:UniProtKB | P | oxidation-reduction process |
| GO:0007603 | TAS:Reactome | P | phototransduction, visible light |
| GO:0042448 | IDA:UniProtKB | P | progesterone metabolic process |
| GO:0051260 | IDA:UniProtKB | P | protein homooligomerization |
| GO:0046683 | IEP:UniProtKB | P | response to organophosphorus |
| GO:0042574 | IDA:UniProtKB | P | retinal metabolic process |
| GO:0001523 | TAS:Reactome | P | retinoid metabolic process |
| GO:0006805 | NAS:UniProtKB | P | xenobiotic metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_24968 | Retinoid metabolism and transport |
| REACT_11048 | Synthesis of bile acids and bile salts via 27-hydroxycholesterol |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member C1
Protein Entry
AK1C1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=5 uM for (s)-tetralol {ECO |
| Catalytic Activity | 17-alpha,20-alpha-dihydroxypregn-4-en-3-one + NAD(P)(+) = 17-alpha-hydroxyprogesterone + NAD(P)H. |
| Catalytic Activity | Indan-1-ol + NAD(P)(+) = indanone + NAD(P)H. |
| Catalytic Activity | Trans-1,2-dihydrobenzene-1,2-diol + NADP(+) = catechol + NADPH. |
| Enzyme Regulation | Inhibited by hexestrol with an IC(50) of 9.5 uM, 1,10-phenanthroline with an IC(50) of 55 uM, 1,7- phenanthroline with an IC(50) of 72 uM, flufenamic acid with an IC(50) of 6.0 uM, indomethacin with an IC(50) of 140 uM, ibuprofen with an IC(50) of 950 uM, lithocholic acid with an IC(50) of 25 uM, ursodeoxycholic acid with an IC(50) of 340 uM and chenodeoxycholic acid with an IC(50) of 570 uM. |
| Function | Converts progesterone to its inactive form, 20-alpha- dihydroxyprogesterone (20-alpha-OHP). In the liver and intestine, may have a role in the transport of bile. May have a role in monitoring the intrahepatic bile acid concentration. Has a low bile-binding ability. May play a role in myelin formation. |
| Similarity | Belongs to the aldo/keto reductase family. |
| Subcellular Location | Cytoplasm. |
| Subunit | Monomer. {ECO |
| Tissue Specificity | Expressed in all tissues tested including liver, prostate, testis, adrenal gland, brain, uterus, mammary gland and keratinocytes. Highest levels found in liver, mammary gland and brain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002152 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 5453543 | RefSeq | NP_001344 | 323 | aldo-keto reductase family 1 member C1 |
Identical Sequences to LMP002152 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5453543 | GenBank | ADL88033.1 | 323 | Sequence 4 from patent US 7705120 |
| GI:5453543 | GenBank | ADT47549.1 | 323 | Sequence 1210 from patent US 7842466 |
| GI:5453543 | GenBank | AEN35375.1 | 323 | Sequence 1303 from patent US 7998689 |
| GI:5453543 | GenBank | AHD75592.1 | 323 | Sequence 17975 from patent US 8586006 |
| GI:5453543 | GenBank | AIC54269.1 | 323 | AKR1C1, partial [synthetic construct] |
| GI:5453543 | PDB | 3NTY | 323 | Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 5-Phenyl,3- Chlorosalicylic Acid |
Related Sequences to LMP002152 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5453543 | EMBL | CAN89486.1 | 324 | unnamed protein product, partial [Homo sapiens] |
| GI:5453543 | EMBL | CAN89487.1 | 337 | unnamed protein product, partial [Homo sapiens] |
| GI:5453543 | GenBank | AAP36952.1 | 324 | Homo sapiens aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase), partial [synthetic construct] |
| GI:5453543 | GenBank | AAX43602.1 | 324 | aldo-keto reductase family 1 member C1, partial [synthetic construct] |
| GI:5453543 | PDB | 1MRQ | 323 | Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone |
| GI:5453543 | PDB | 3GUG | 323 | Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid |