Gene/Proteome Database (LMPD)

LMPD ID
LMP002172
Gene ID
6715
Species
Homo sapiens (Human)
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Gene Symbol
SRD5A1
Synonyms
S5AR 1
Alternate Names
3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; 5-alpha reductase; steroid 5-alpha-reductase 1; steroid 5-alpha-reductase type I; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1
Chromosome
5
Map Location
5p15
EC Number
1.3.1.22
Summary
Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]
Orthologs
View orthologs and multiple alignments for SRD5A1

Proteins

3-oxo-5-alpha-steroid 4-dehydrogenase 1
Refseq ID NP_001038
Protein GI 4507201
UniProt ID P18405
mRNA ID NM_001047
Length 259
RefSeq Status VALIDATED
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF

Gene Information

Entrez Gene ID
6715
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Gene Symbol
SRD5A1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003865 IDA:UniProtKB F 3-oxo-5-alpha-steroid 4-dehydrogenase activity
GO:0047751 IEA:UniProtKB-EC F cholestenone 5-alpha-reductase activity
GO:0009055 TAS:UniProtKB F electron carrier activity
GO:0006702 TAS:Reactome P androgen biosynthetic process
GO:0030154 IEA:UniProtKB-KW P cell differentiation
GO:0007530 NAS:ProtInc P sex determination
GO:0007548 IEA:UniProtKB-KW P sex differentiation
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0008202 TAS:Reactome P steroid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00140 Steroid hormone biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY66-378 androgen biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_11059 Androgen biosynthesis
REACT_11057 Metabolism of steroid hormones and vitamin D

Domain Information

InterPro Annotations

Accession Description
IPR016636 3-oxo-5-alpha-steroid 4-dehydrogenase
IPR001104 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

UniProt Annotations

Entry Information

Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Protein Entry
S5A1_HUMAN
UniProt ID
P18405
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties pH dependence: Optimally active at alkaline pHs.;
Catalytic Activity A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH.
Function Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5- alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Induction Its expression is regulated by androgens such as testosterone.
Similarity Belongs to the steroid 5-alpha reductase family.
Subcellular Location Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Tissue Specificity Liver and prostate (at a low level).
Web Resource Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/srd5a1/";
Web Resource Name=Wikipedia; Note=5-alpha reductase entry; URL="http://en.wikipedia.org/wiki/5_alpha_reductase";

Identical and Related Proteins

Unique RefSeq proteins for LMP002172 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4507201 RefSeq NP_001038 259 3-oxo-5-alpha-steroid 4-dehydrogenase 1

Identical Sequences to LMP002172 proteins

Reference Database Accession Length Protein Name
GI:4507201 GenBank JAA03649.1 259 steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [Pan troglodytes]
GI:4507201 GenBank JAA20970.1 259 steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [Pan troglodytes]
GI:4507201 GenBank JAA23407.1 259 steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [Pan troglodytes]
GI:4507201 GenBank JAA34957.1 259 steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [Pan troglodytes]
GI:4507201 GenBank AIC55165.1 259 SRD5A1, partial [synthetic construct]
GI:4507201 RefSeq XP_003808014.1 259 PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 [Pan paniscus]

Related Sequences to LMP002172 proteins

Reference Database Accession Length Protein Name
GI:4507201 GenBank AAE95371.1 243 Sequence 5 from patent US 6352846
GI:4507201 GenBank AAP36172.1 260 Homo sapiens steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1), partial [synthetic construct]
GI:4507201 GenBank AAX29468.1 260 steroid-5-alpha-reductase alpha polypeptide 1, partial [synthetic construct]
GI:4507201 GenBank AAX29469.1 260 steroid-5-alpha-reductase alpha polypeptide 1, partial [synthetic construct]
GI:4507201 RefSeq XP_003263271.1 259 PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 [Nomascus leucogenys]
GI:4507201 RefSeq XP_004059108.1 259 PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 [Gorilla gorilla gorilla]