Gene/Proteome Database (LMPD)
LMPD ID
LMP002214
Gene ID
Species
Mus musculus (Mouse)
Gene Name
steroidogenic acute regulatory protein
Gene Symbol
Synonyms
AV363654; D8Ertd419e
Alternate Names
steroidogenic acute regulatory protein, mitochondrial; stARD1; START domain-containing protein 1; luteinizing hormone-induced protein
Chromosome
8
Map Location
8 A2|8 14.17 cM
Proteins
steroidogenic acute regulatory protein, mitochondrial precursor | |
---|---|
Refseq ID | NP_035615 |
Protein GI | 31543776 |
UniProt ID | P51557 |
mRNA ID | NM_011485 |
Length | 284 |
RefSeq Status | PROVISIONAL |
MFLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNWRALGDSSPGWMGQVRRRSSLLGSQLEATLYSDQELSYIQQGEVAMQKALGILNNQEGWKKESQQENGDEVLSKMVPDVGKVFRLEVVVDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLQRIGKDTVITHELAAAAAGNLVGPRDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKTIINQVLSQTQIEFANHLRKRLEASPASEAQC | |
transit_peptide: 1..62 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (P51557.1) calculated_mol_wt: 6977 peptide sequence: MFLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNWRALGDSSPGWMGQVRRRSSLLGSQL mat_peptide: 63..284 product: Steroidogenic acute regulatory protein, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51557.1) calculated_mol_wt: 24667 peptide sequence: EATLYSDQELSYIQQGEVAMQKALGILNNQEGWKKESQQENGDEVLSKMVPDVGKVFRLEVVVDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLQRIGKDTVITHELAAAAAGNLVGPRDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKTIINQVLSQTQIEFANHLRKRLEASPASEAQC |
Gene Information
Entrez Gene ID
Gene Name
steroidogenic acute regulatory protein
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0030061 | IEA:Ensembl | C | mitochondrial crista |
GO:0005758 | IEA:Ensembl | C | mitochondrial intermembrane space |
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0043025 | IEA:Ensembl | C | neuronal cell body |
GO:0043005 | IEA:Ensembl | C | neuron projection |
GO:0015485 | IDA:MGI | F | cholesterol binding |
GO:0006699 | IEA:Ensembl | P | bile acid biosynthetic process |
GO:0018879 | IEA:Ensembl | P | biphenyl metabolic process |
GO:0007420 | IEA:Ensembl | P | brain development |
GO:0044255 | IMP:MGI | P | cellular lipid metabolic process |
GO:0071312 | IEA:Ensembl | P | cellular response to alkaloid |
GO:0071236 | IEA:Ensembl | P | cellular response to antibiotic |
GO:0071276 | IEA:Ensembl | P | cellular response to cadmium ion |
GO:0071320 | IEA:Ensembl | P | cellular response to cAMP |
GO:0071549 | IEA:Ensembl | P | cellular response to dexamethasone stimulus |
GO:0071872 | IEA:Ensembl | P | cellular response to epinephrine stimulus |
GO:0044344 | IEA:Ensembl | P | cellular response to fibroblast growth factor stimulus |
GO:0071372 | IEA:Ensembl | P | cellular response to follicle-stimulating hormone stimulus |
GO:0071333 | IEA:Ensembl | P | cellular response to glucose stimulus |
GO:0071378 | IEA:Ensembl | P | cellular response to growth hormone stimulus |
GO:0032869 | IEA:Ensembl | P | cellular response to insulin stimulus |
GO:0035457 | IEA:Ensembl | P | cellular response to interferon-alpha |
GO:0071346 | IEA:Ensembl | P | cellular response to interferon-gamma |
GO:0071222 | IEA:Ensembl | P | cellular response to lipopolysaccharide |
GO:0071373 | IEA:Ensembl | P | cellular response to luteinizing hormone stimulus |
GO:0071560 | IEA:Ensembl | P | cellular response to transforming growth factor beta stimulus |
GO:0008203 | IEA:UniProtKB-UniPathway | P | cholesterol metabolic process |
GO:0042747 | IEA:Ensembl | P | circadian sleep/wake cycle, REM sleep |
GO:0018894 | IEA:Ensembl | P | dibenzo-p-dioxin metabolic process |
GO:0016101 | IEA:Ensembl | P | diterpenoid metabolic process |
GO:0006703 | IEA:Ensembl | P | estrogen biosynthetic process |
GO:0050756 | IEA:Ensembl | P | fractalkine metabolic process |
GO:0008211 | IMP:MGI | P | glucocorticoid metabolic process |
GO:0017143 | IEA:Ensembl | P | insecticide metabolic process |
GO:0032367 | IEA:Ensembl | P | intracellular cholesterol transport |
GO:0008584 | IEA:Ensembl | P | male gonad development |
GO:0043524 | IEA:Ensembl | P | negative regulation of neuron apoptotic process |
GO:0018958 | IEA:Ensembl | P | phenol-containing compound metabolic process |
GO:0018963 | IEA:Ensembl | P | phthalate metabolic process |
GO:0010628 | IEA:Ensembl | P | positive regulation of gene expression |
GO:0050769 | IEA:Ensembl | P | positive regulation of neurogenesis |
GO:0006701 | IEA:Ensembl | P | progesterone biosynthetic process |
GO:0048168 | IEA:Ensembl | P | regulation of neuronal synaptic plasticity |
GO:0050810 | IDA:MGI | P | regulation of steroid biosynthetic process |
GO:0014823 | IEA:Ensembl | P | response to activity |
GO:0051412 | IEA:Ensembl | P | response to corticosterone |
GO:0042493 | IEA:Ensembl | P | response to drug |
GO:0043627 | IEA:Ensembl | P | response to estrogen |
GO:0045471 | IEA:Ensembl | P | response to ethanol |
GO:0060992 | IEA:Ensembl | P | response to fungicide |
GO:0009635 | IEA:Ensembl | P | response to herbicide |
GO:0042542 | IEA:Ensembl | P | response to hydrogen peroxide |
GO:0010212 | IEA:Ensembl | P | response to ionizing radiation |
GO:0010288 | IEA:Ensembl | P | response to lead ion |
GO:0044321 | IEA:Ensembl | P | response to leptin |
GO:0035094 | IEA:Ensembl | P | response to nicotine |
GO:0007584 | IEA:Ensembl | P | response to nutrient |
GO:0061370 | IEA:Ensembl | P | testosterone biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
steroidogenic acute regulatory protein
Protein Entry
STAR_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Plays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Transporter that binds to and transport cholesterol through the intermembrane space of the mitochondrion (Probable). {ECO:0000305}. |
Pathway | Steroid metabolism; cholesterol metabolism. |
Similarity | Contains 1 START domain. {ECO:0000255|PROSITE- ProRule:PRU00197}. |
Subcellular Location | Mitochondrion {ECO:0000269|PubMed:7588255}. |
Subunit | May interact with TSPO. {ECO:0000250}. |
Tissue Specificity | Expressed within glia and neurons in discrete regions of the brain. {ECO:0000269|PubMed:12486153}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002214 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
31543776 | RefSeq | NP_035615 | 284 | steroidogenic acute regulatory protein, mitochondrial precursor |
Identical Sequences to LMP002214 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31543776 | DBBJ | BAC35791.1 | 284 | unnamed protein product [Mus musculus] |
GI:31543776 | DBBJ | BAE22934.1 | 284 | unnamed protein product [Mus musculus] |
GI:31543776 | GenBank | AAK50433.2 | 284 | steroidogenic acute regulatory protein [Mus musculus] |
GI:31543776 | GenBank | AAH82283.1 | 284 | Steroidogenic acute regulatory protein [Mus musculus] |
GI:31543776 | GenBank | AAY77664.1 | 284 | Sequence 2 from patent US 6903183 |
GI:31543776 | GenBank | EDL32820.1 | 284 | steroidogenic acute regulatory protein [Mus musculus] |
Related Sequences to LMP002214 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31543776 | DBBJ | BAA19245.1 | 284 | steroidogenic acute regulatory protein [Rattus norvegicus] |
GI:31543776 | DBBJ | BAB31842.1 | 284 | unnamed protein product [Mus musculus] |
GI:31543776 | GenBank | AAE60938.1 | 276 | Sequence 2 from patent US 6194555 |
GI:31543776 | GenBank | AAU84904.1 | 284 | steroidogenic acute regulatory protein [Rattus norvegicus] |
GI:31543776 | GenBank | AAH88859.1 | 284 | Steroidogenic acute regulatory protein [Rattus norvegicus] |
GI:31543776 | GenBank | EDM09070.1 | 284 | steroidogenic acute regulatory protein [Rattus norvegicus] |