Gene/Proteome Database (LMPD)

LMPD ID
LMP002214
Gene ID
Species
Mus musculus (Mouse)
Gene Name
steroidogenic acute regulatory protein
Gene Symbol
Synonyms
AV363654; D8Ertd419e
Alternate Names
steroidogenic acute regulatory protein, mitochondrial; stARD1; START domain-containing protein 1; luteinizing hormone-induced protein
Chromosome
8
Map Location
8 A2|8 14.17 cM

Proteins

steroidogenic acute regulatory protein, mitochondrial precursor
Refseq ID NP_035615
Protein GI 31543776
UniProt ID P51557
mRNA ID NM_011485
Length 284
RefSeq Status PROVISIONAL
MFLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNWRALGDSSPGWMGQVRRRSSLLGSQLEATLYSDQELSYIQQGEVAMQKALGILNNQEGWKKESQQENGDEVLSKMVPDVGKVFRLEVVVDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLQRIGKDTVITHELAAAAAGNLVGPRDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKTIINQVLSQTQIEFANHLRKRLEASPASEAQC
transit_peptide: 1..62 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (P51557.1) calculated_mol_wt: 6977 peptide sequence: MFLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNWRALGDSSPGWMGQVRRRSSLLGSQL mat_peptide: 63..284 product: Steroidogenic acute regulatory protein, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51557.1) calculated_mol_wt: 24667 peptide sequence: EATLYSDQELSYIQQGEVAMQKALGILNNQEGWKKESQQENGDEVLSKMVPDVGKVFRLEVVVDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLQRIGKDTVITHELAAAAAGNLVGPRDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKTIINQVLSQTQIEFANHLRKRLEASPASEAQC

Gene Information

Entrez Gene ID
Gene Name
steroidogenic acute regulatory protein
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0030061 IEA:Ensembl C mitochondrial crista
GO:0005758 IEA:Ensembl C mitochondrial intermembrane space
GO:0005739 IDA:MGI C mitochondrion
GO:0043005 IEA:Ensembl C neuron projection
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0015485 IDA:MGI F cholesterol binding
GO:0006699 IEA:Ensembl P bile acid biosynthetic process
GO:0018879 IEA:Ensembl P biphenyl metabolic process
GO:0007420 IEA:Ensembl P brain development
GO:0044255 IMP:MGI P cellular lipid metabolic process
GO:0071312 IEA:Ensembl P cellular response to alkaloid
GO:0071236 IEA:Ensembl P cellular response to antibiotic
GO:0071320 IEA:Ensembl P cellular response to cAMP
GO:0071276 IEA:Ensembl P cellular response to cadmium ion
GO:0071549 IEA:Ensembl P cellular response to dexamethasone stimulus
GO:0071872 IEA:Ensembl P cellular response to epinephrine stimulus
GO:0044344 IEA:Ensembl P cellular response to fibroblast growth factor stimulus
GO:0071372 IEA:Ensembl P cellular response to follicle-stimulating hormone stimulus
GO:0071333 IEA:Ensembl P cellular response to glucose stimulus
GO:0071378 IEA:Ensembl P cellular response to growth hormone stimulus
GO:0032869 IEA:Ensembl P cellular response to insulin stimulus
GO:0035457 IEA:Ensembl P cellular response to interferon-alpha
GO:0071346 IEA:Ensembl P cellular response to interferon-gamma
GO:0071222 IEA:Ensembl P cellular response to lipopolysaccharide
GO:0071373 IEA:Ensembl P cellular response to luteinizing hormone stimulus
GO:0071560 IEA:Ensembl P cellular response to transforming growth factor beta stimulus
GO:0008203 IEA:UniProtKB-UniPathway P cholesterol metabolic process
GO:0042747 IEA:Ensembl P circadian sleep/wake cycle, REM sleep
GO:0018894 IEA:Ensembl P dibenzo-p-dioxin metabolic process
GO:0016101 IEA:Ensembl P diterpenoid metabolic process
GO:0006703 IEA:Ensembl P estrogen biosynthetic process
GO:0050756 IEA:Ensembl P fractalkine metabolic process
GO:0008211 IMP:MGI P glucocorticoid metabolic process
GO:0017143 IEA:Ensembl P insecticide metabolic process
GO:0032367 IEA:Ensembl P intracellular cholesterol transport
GO:0008584 IEA:Ensembl P male gonad development
GO:0043524 IEA:Ensembl P negative regulation of neuron apoptotic process
GO:0018958 IEA:Ensembl P phenol-containing compound metabolic process
GO:0018963 IEA:Ensembl P phthalate metabolic process
GO:0010628 IEA:Ensembl P positive regulation of gene expression
GO:0050769 IEA:Ensembl P positive regulation of neurogenesis
GO:0006701 IEA:Ensembl P progesterone biosynthetic process
GO:0048168 IEA:Ensembl P regulation of neuronal synaptic plasticity
GO:0050810 IDA:MGI P regulation of steroid biosynthetic process
GO:0014823 IEA:Ensembl P response to activity
GO:0051412 IEA:Ensembl P response to corticosterone
GO:0042493 IEA:Ensembl P response to drug
GO:0043627 IEA:Ensembl P response to estrogen
GO:0045471 IEA:Ensembl P response to ethanol
GO:0060992 IEA:Ensembl P response to fungicide
GO:0009635 IEA:Ensembl P response to herbicide
GO:0042542 IEA:Ensembl P response to hydrogen peroxide
GO:0010212 IEA:Ensembl P response to ionizing radiation
GO:0010288 IEA:Ensembl P response to lead ion
GO:0044321 IEA:Ensembl P response to leptin
GO:0035094 IEA:Ensembl P response to nicotine
GO:0007584 IEA:Ensembl P response to nutrient
GO:0061370 IEA:Ensembl P testosterone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko04913 Ovarian steroidogenesis
mmu04913 Ovarian steroidogenesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5893447 Metabolism of steroid hormones and vitamin D
5893449 Pregnenolone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom
IPR000799 Steroidogenic acute regulatory protein-like

UniProt Annotations

Entry Information

Gene Name
steroidogenic acute regulatory protein
Protein Entry
STAR_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function Plays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Transporter that binds to and transport cholesterol through the intermembrane space of the mitochondrion (Probable). {ECO:0000305}.
Pathway Steroid metabolism; cholesterol metabolism.
Similarity Contains 1 START domain. {ECO:0000255|PROSITE- ProRule:PRU00197}.
Subcellular Location Mitochondrion {ECO:0000269|PubMed:7588255}.
Subunit May interact with TSPO. {ECO:0000250}.
Tissue Specificity Expressed within glia and neurons in discrete regions of the brain. {ECO:0000269|PubMed:12486153}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002214 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
31543776 RefSeq NP_035615 284 steroidogenic acute regulatory protein, mitochondrial precursor

Identical Sequences to LMP002214 proteins

Reference Database Accession Length Protein Name
GI:31543776 DBBJ BAC35791.1 284 unnamed protein product [Mus musculus]
GI:31543776 DBBJ BAE22934.1 284 unnamed protein product [Mus musculus]
GI:31543776 GenBank AAK50433.2 284 steroidogenic acute regulatory protein [Mus musculus]
GI:31543776 GenBank AAH82283.1 284 Steroidogenic acute regulatory protein [Mus musculus]
GI:31543776 GenBank AAY77664.1 284 Sequence 2 from patent US 6903183
GI:31543776 GenBank EDL32820.1 284 steroidogenic acute regulatory protein [Mus musculus]

Related Sequences to LMP002214 proteins

Reference Database Accession Length Protein Name
GI:31543776 DBBJ BAA19245.1 284 steroidogenic acute regulatory protein [Rattus norvegicus]
GI:31543776 DBBJ BAB31842.1 284 unnamed protein product [Mus musculus]
GI:31543776 GenBank AAE60938.1 276 Sequence 2 from patent US 6194555
GI:31543776 GenBank AAU84904.1 284 steroidogenic acute regulatory protein [Rattus norvegicus]
GI:31543776 GenBank AAH88859.1 284 Steroidogenic acute regulatory protein [Rattus norvegicus]
GI:31543776 GenBank EDM09070.1 284 steroidogenic acute regulatory protein [Rattus norvegicus]