Gene/Proteome Database (LMPD)
LMPD ID
LMP002225
Gene ID
Species
Homo sapiens (Human)
Gene Name
solute carrier family 10, member 4
Gene Symbol
Synonyms
P4
Alternate Names
sodium/bile acid cotransporter 4; bile acid transporter SLC10A4; Na(+)/bile acid cotransporter 4; solute carrier family 10 (sodium/bile acid cotransporter family), member 4
Chromosome
4
Map Location
4p11
Proteins
sodium/bile acid cotransporter 4 | |
---|---|
Refseq ID | NP_689892 |
Protein GI | 24308414 |
UniProt ID | Q96EP9 |
mRNA ID | NM_152679 |
Length | 437 |
RefSeq Status | VALIDATED |
MDGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLGPGPSFGFSPGPTPTPEPTTSGLAGGAASHGPSPFPRPWAPHALPFWDTPLNHGLNVFVGAALCITMLGLGCTVDVNHFGAHVRRPVGALLAALCQFGLLPLLAFLLALAFKLDEVAAVAVLLCGCCPGGNLSNLMSLLVDGDMNLSIIMTISSTLLALVLMPLCLWIYSWAWINTPIVQLLPLGTVTLTLCSTLIPIGLGVFIRYKYSRVADYIVKVSLWSLLVTLVVLFIMTGTMLGPELLASIPAAVYVIAIFMPLAGYASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTSL |
Gene Information
Entrez Gene ID
Gene Name
solute carrier family 10, member 4
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0008508 | IEA:InterPro | F | bile acid:sodium symporter activity |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002657 | Bile acid:sodium symporter/arsenical resistance protein Acr3 |
UniProt Annotations
Entry Information
Gene Name
solute carrier family 10, member 4
Protein Entry
NTCP4_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Function | Transporter for bile acids. |
Ptm | Activated following N-terminal proteolytic cleavage by thrombin and/or proteases. |
Similarity | Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. |
Subcellular Location | Cell membrane ; Multi-pass membrane protein . |
Tissue Specificity | Highly expressed in brain and small intestine, and moderately expressed in colon, heart, prostate, and testis. Very low levels were detected in kidney, liver, ovary, placenta, spleen, and thymus. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002225 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
24308414 | RefSeq | NP_689892 | 437 | sodium/bile acid cotransporter 4 |
Identical Sequences to LMP002225 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:24308414 | GenBank | AAH12048.2 | 437 | Solute carrier family 10 (sodium/bile acid cotransporter family), member 4 [Homo sapiens] |
GI:24308414 | GenBank | AAW30130.1 | 437 | bile acid transporter SLC10A4 [Homo sapiens] |
GI:24308414 | GenBank | EAW93061.1 | 437 | solute carrier family 10 (sodium/bile acid cotransporter family), member 4 [Homo sapiens] |
GI:24308414 | GenBank | ABM83554.1 | 437 | solute carrier family 10 (sodium/bile acid cotransporter family), member 4 [synthetic construct] |
GI:24308414 | GenBank | ABW03505.1 | 437 | solute carrier family 10 (sodium/bile acid cotransporter family), member 4, partial [synthetic construct] |
GI:24308414 | SwissProt | Q96EP9.2 | 437 | RecName: Full=Sodium/bile acid cotransporter 4; AltName: Full=Na(+)/bile acid cotransporter 4; AltName: Full=Solute carrier family 10 member 4 [Homo sapiens] |
Related Sequences to LMP002225 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:24308414 | RefSeq | XP_001103529.1 | 436 | PREDICTED: sodium/bile acid cotransporter 4 [Macaca mulatta] |
GI:24308414 | RefSeq | XP_002814774.1 | 437 | PREDICTED: sodium/bile acid cotransporter 4 [Pongo abelii] |
GI:24308414 | RefSeq | XP_003258477.1 | 437 | PREDICTED: sodium/bile acid cotransporter 4 [Nomascus leucogenys] |
GI:24308414 | RefSeq | XP_004038695.1 | 437 | PREDICTED: sodium/bile acid cotransporter 4 [Gorilla gorilla gorilla] |
GI:24308414 | RefSeq | XP_008015631.1 | 437 | PREDICTED: sodium/bile acid cotransporter 4 [Chlorocebus sabaeus] |
GI:24308414 | RefSeq | XP_010384672.1 | 437 | PREDICTED: sodium/bile acid cotransporter 4 [Rhinopithecus roxellana] |