Gene/Proteome Database (LMPD)

LMPD ID
LMP002225
Gene ID
Species
Homo sapiens (Human)
Gene Name
solute carrier family 10, member 4
Gene Symbol
Synonyms
P4
Alternate Names
sodium/bile acid cotransporter 4; bile acid transporter SLC10A4; Na(+)/bile acid cotransporter 4; solute carrier family 10 (sodium/bile acid cotransporter family), member 4
Chromosome
4
Map Location
4p11

Proteins

sodium/bile acid cotransporter 4
Refseq ID NP_689892
Protein GI 24308414
UniProt ID Q96EP9
mRNA ID NM_152679
Length 437
RefSeq Status VALIDATED
MDGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLGPGPSFGFSPGPTPTPEPTTSGLAGGAASHGPSPFPRPWAPHALPFWDTPLNHGLNVFVGAALCITMLGLGCTVDVNHFGAHVRRPVGALLAALCQFGLLPLLAFLLALAFKLDEVAAVAVLLCGCCPGGNLSNLMSLLVDGDMNLSIIMTISSTLLALVLMPLCLWIYSWAWINTPIVQLLPLGTVTLTLCSTLIPIGLGVFIRYKYSRVADYIVKVSLWSLLVTLVVLFIMTGTMLGPELLASIPAAVYVIAIFMPLAGYASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTSL

Gene Information

Entrez Gene ID
Gene Name
solute carrier family 10, member 4
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0008508 IEA:InterPro F bile acid:sodium symporter activity

Domain Information

InterPro Annotations

Accession Description
IPR002657 Bile acid:sodium symporter/arsenical resistance protein Acr3

UniProt Annotations

Entry Information

Gene Name
solute carrier family 10, member 4
Protein Entry
NTCP4_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Function Transporter for bile acids.
Ptm Activated following N-terminal proteolytic cleavage by thrombin and/or proteases.
Similarity Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.
Subcellular Location Cell membrane ; Multi-pass membrane protein .
Tissue Specificity Highly expressed in brain and small intestine, and moderately expressed in colon, heart, prostate, and testis. Very low levels were detected in kidney, liver, ovary, placenta, spleen, and thymus.

Identical and Related Proteins

Unique RefSeq proteins for LMP002225 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
24308414 RefSeq NP_689892 437 sodium/bile acid cotransporter 4

Identical Sequences to LMP002225 proteins

Reference Database Accession Length Protein Name
GI:24308414 GenBank AAH12048.2 437 Solute carrier family 10 (sodium/bile acid cotransporter family), member 4 [Homo sapiens]
GI:24308414 GenBank AAW30130.1 437 bile acid transporter SLC10A4 [Homo sapiens]
GI:24308414 GenBank EAW93061.1 437 solute carrier family 10 (sodium/bile acid cotransporter family), member 4 [Homo sapiens]
GI:24308414 GenBank ABM83554.1 437 solute carrier family 10 (sodium/bile acid cotransporter family), member 4 [synthetic construct]
GI:24308414 GenBank ABW03505.1 437 solute carrier family 10 (sodium/bile acid cotransporter family), member 4, partial [synthetic construct]
GI:24308414 SwissProt Q96EP9.2 437 RecName: Full=Sodium/bile acid cotransporter 4; AltName: Full=Na(+)/bile acid cotransporter 4; AltName: Full=Solute carrier family 10 member 4 [Homo sapiens]

Related Sequences to LMP002225 proteins

Reference Database Accession Length Protein Name
GI:24308414 RefSeq XP_001103529.1 436 PREDICTED: sodium/bile acid cotransporter 4 [Macaca mulatta]
GI:24308414 RefSeq XP_002814774.1 437 PREDICTED: sodium/bile acid cotransporter 4 [Pongo abelii]
GI:24308414 RefSeq XP_003258477.1 437 PREDICTED: sodium/bile acid cotransporter 4 [Nomascus leucogenys]
GI:24308414 RefSeq XP_004038695.1 437 PREDICTED: sodium/bile acid cotransporter 4 [Gorilla gorilla gorilla]
GI:24308414 RefSeq XP_008015631.1 437 PREDICTED: sodium/bile acid cotransporter 4 [Chlorocebus sabaeus]
GI:24308414 RefSeq XP_010384672.1 437 PREDICTED: sodium/bile acid cotransporter 4 [Rhinopithecus roxellana]