Gene/Proteome Database (LMPD)
LMPD ID
LMP002255
Gene ID
Species
Homo sapiens (Human)
Gene Name
leukotriene B4 receptor
Gene Symbol
Synonyms
BLT1; BLTR; CMKRL1; GPR16; LTB4R1; LTBR1; P2RY7; P2Y7
Alternate Names
leukotriene B4 receptor 1; LTB4-R1; LTB4-R 1; P2Y purinoceptor 7; chemokine receptor-like 1; G protein-coupled receptor 16; G-protein coupled receptor 16; chemoattractant receptor-like 1; purinergic receptor P2Y, G-protein coupled, 7
Chromosome
14
Map Location
14q11.2-q12
Proteins
leukotriene B4 receptor 1 | |
---|---|
Refseq ID | NP_001137391 |
Protein GI | 221218998 |
UniProt ID | Q15722 |
mRNA ID | NM_001143919 |
Length | 352 |
RefSeq Status | VALIDATED |
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005887 | TAS:ProtInc | C | integral component of plasma membrane |
GO:0005886 | TAS:Reactome | C | plasma membrane |
GO:0001632 | IEA:Ensembl | F | leukotriene B4 receptor activity |
GO:0004974 | TAS:ProtInc | F | leukotriene receptor activity |
GO:0000166 | TAS:ProtInc | F | nucleotide binding |
GO:0007186 | TAS:ProtInc | P | G-protein coupled receptor signaling pathway |
GO:0006928 | TAS:ProtInc | P | cellular component movement |
GO:0006955 | TAS:ProtInc | P | immune response |
GO:0006954 | TAS:ProtInc | P | inflammatory response |
GO:0006936 | TAS:ProtInc | P | muscle contraction |
GO:0007200 | TAS:ProtInc | P | phospholipase C-activating G-protein coupled receptor signaling pathway |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_18302 | Leukotriene receptors |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response. |
Ptm | Phosphorylated by GRK6 upon leukotriene B4 binding; which promotes desensitization. |
Sequence Caution | Sequence=AAB16747.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Belongs to the G-protein coupled receptor 1 family. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Tissue Specificity | Expressed at highest levels in heart, skeletal muscle and at lower levels in brain and liver. High level of expression in lymphoid tissues. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002255 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
221218998 | RefSeq | NP_001137391 | 352 | leukotriene B4 receptor 1 |
Identical Sequences to LMP002255 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:221218998 | DBBJ | BAJ20610.1 | 352 | leukotriene B4 receptor, partial [synthetic construct] |
GI:221218998 | GenBank | AAP84348.1 | 352 | leukotriene B4 receptor [Homo sapiens] |
GI:221218998 | GenBank | EAW66029.1 | 352 | leukotriene B4 receptor [Homo sapiens] |
GI:221218998 | GenBank | ACC24508.1 | 352 | Sequence 32 from patent US 7341840 |
GI:221218998 | GenBank | ADS48760.1 | 352 | Sequence 32 from patent US 7803557 |
GI:221218998 | RefSeq | NP_858043.1 | 352 | leukotriene B4 receptor 1 [Homo sapiens] |
Related Sequences to LMP002255 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:221218998 | EMBL | CAC42549.1 | 377 | unnamed protein product [Homo sapiens] |
GI:221218998 | GenBank | AAB16747.1 | 377 | putative G-protein-coupled receptor [Homo sapiens] |
GI:221218998 | GenBank | AAP35931.1 | 352 | leukotriene B4 receptor [Homo sapiens] |
GI:221218998 | GenBank | AAX32664.1 | 352 | leukotriene B4 receptor [synthetic construct] |
GI:221218998 | GenBank | ABW03628.1 | 352 | leukotriene B4 receptor [synthetic construct] |
GI:221218998 | GenBank | AIC61952.1 | 352 | LTB4R, partial [synthetic construct] |