Gene/Proteome Database (LMPD)

LMPD ID
LMP002284
Gene ID
948
Species
Homo sapiens (Human)
Gene Name
CD36 molecule (thrombospondin receptor)
Gene Symbol
CD36
Synonyms
BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3
Chromosome
7
Map Location
7q11.2
Summary
The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014]
Orthologs
View orthologs and multiple alignments for CD36

Proteins

platelet glycoprotein 4 isoform 1
Refseq ID NP_001120915
Protein GI 188536063
UniProt ID P16671
mRNA ID NM_001127443
Length 472
RefSeq Status REVIEWED
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
platelet glycoprotein 4 isoform 1
Refseq ID NP_001001547
Protein GI 48375176
UniProt ID P16671
mRNA ID NM_001001547
Length 472
RefSeq Status REVIEWED
Protein sequence is identical to GI:188536063 (mRNA isoform)
platelet glycoprotein 4 isoform 1
Refseq ID NP_001001548
Protein GI 48375180
UniProt ID P16671
mRNA ID NM_001001548
Length 472
RefSeq Status REVIEWED
Protein sequence is identical to GI:188536063 (mRNA isoform)
platelet glycoprotein 4 isoform 1
Refseq ID NP_001120916
Protein GI 188536065
UniProt ID P16671
mRNA ID NM_001127444
Length 472
RefSeq Status REVIEWED
Protein sequence is identical to GI:188536063 (mRNA isoform)
platelet glycoprotein 4 isoform 1
Refseq ID NP_000063
Protein GI 48375178
UniProt ID P16671
mRNA ID NM_000072
Length 472
RefSeq Status REVIEWED
Protein sequence is identical to GI:188536063 (mRNA isoform)
platelet glycoprotein 4 isoform 2
Refseq ID NP_001276837
Protein GI 583966140
UniProt ID P16671
mRNA ID NM_001289908
Length 433
RefSeq Status REVIEWED
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
platelet glycoprotein 4 isoform 3
Refseq ID NP_001276838
Protein GI 583966144
UniProt ID P16671
mRNA ID NM_001289909
Length 412
RefSeq Status REVIEWED
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
platelet glycoprotein 4 isoform 4
Refseq ID NP_001276840
Protein GI 583966144
UniProt ID P16671
mRNA ID NM_001289911
Length 412
RefSeq Status REVIEWED
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Gene Information

Entrez Gene ID
948
Gene Name
CD36 molecule (thrombospondin receptor)
Gene Symbol
CD36
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:Ensembl C Golgi apparatus
GO:0005581 IEA:UniProtKB-KW C collagen trimer
GO:0009897 IEA:Ensembl C external side of plasma membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0045121 IEA:Ensembl C membrane raft
GO:0008035 IEA:Ensembl F high-density lipoprotein particle binding
GO:0070892 IEA:Ensembl F lipoteichoic acid receptor activity
GO:0030169 IEA:Ensembl F low-density lipoprotein particle binding
GO:0005041 IEA:Ensembl F low-density lipoprotein receptor activity
GO:0043277 IEA:Ensembl P apoptotic cell clearance
GO:0007155 IEA:InterPro P cell adhesion
GO:0007166 IEA:Ensembl P cell surface receptor signaling pathway
GO:0071221 IEA:Ensembl P cellular response to bacterial lipopeptide
GO:0071447 IEA:Ensembl P cellular response to hydroperoxide
GO:0071222 IEA:Ensembl P cellular response to lipopolysaccharide
GO:0071223 IEA:Ensembl P cellular response to lipoteichoic acid
GO:0030301 IEA:Ensembl P cholesterol transport
GO:0050830 IEA:Ensembl P defense response to Gram-positive bacterium
GO:0019915 IEA:Ensembl P lipid storage
GO:0042953 IEA:Ensembl P lipoprotein transport
GO:0034383 IEA:Ensembl P low-density lipoprotein particle clearance
GO:0055096 IEA:Ensembl P low-density lipoprotein particle mediated signaling
GO:0044130 IEA:Ensembl P negative regulation of growth of symbiont in host
GO:0042992 IEA:Ensembl P negative regulation of transcription factor import into nucleus
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0006910 IEA:Ensembl P phagocytosis, recognition
GO:0043123 IEA:Ensembl P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043410 IEA:Ensembl P positive regulation of MAPK cascade
GO:0030194 IEA:Ensembl P positive regulation of blood coagulation
GO:2000334 IEA:Ensembl P positive regulation of blood microparticle formation
GO:0010886 IEA:Ensembl P positive regulation of cholesterol storage
GO:0032735 IEA:Ensembl P positive regulation of interleukin-12 production
GO:0032755 IEA:Ensembl P positive regulation of interleukin-6 production
GO:0060907 IEA:Ensembl P positive regulation of macrophage cytokine production
GO:0010744 IEA:Ensembl P positive regulation of macrophage derived foam cell differentiation
GO:0050731 IEA:Ensembl P positive regulation of peptidyl-tyrosine phosphorylation
GO:0060100 IEA:Ensembl P positive regulation of phagocytosis, engulfment
GO:2000379 IEA:Ensembl P positive regulation of reactive oxygen species metabolic process
GO:0032760 IEA:Ensembl P positive regulation of tumor necrosis factor production
GO:2000121 IEA:Ensembl P regulation of removal of superoxide radicals
GO:0035634 IEA:Ensembl P response to stilbenoid

KEGG Pathway Links

KEGG Pathway ID Description
hsa04152 AMPK signaling pathway
hsa04975 Fat digestion and absorption

Domain Information

InterPro Annotations

Accession Description
IPR005428 Adhesion molecule CD36
IPR002159 CD36 antigen

UniProt Annotations

Entry Information

Gene Name
CD36 molecule (thrombospondin receptor)
Protein Entry
CD36_HUMAN
UniProt ID
P16671
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP002284 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
188536063 RefSeq NP_001120915 472 platelet glycoprotein 4 isoform 1
583966140 RefSeq NP_001276837 433 platelet glycoprotein 4 isoform 2
583966144 RefSeq NP_001276838 412 platelet glycoprotein 4 isoform 3
583966144 RefSeq NP_001276840 412 platelet glycoprotein 4 isoform 4

Identical Sequences to LMP002284 proteins

Reference Database Accession Length Protein Name
GI:583966144 GenBank ADI80543.1 412 platelet glycoprotein IV variant [Homo sapiens]
GI:583966144 GenBank ADI80543.1 412 platelet glycoprotein IV variant [Homo sapiens]
GI:583966140 GenBank ADI80546.1 433 platelet glycoprotein IV variant [Homo sapiens]
GI:188536063 GenBank AHD70051.1 472 Sequence 2140 from patent US 8586006
GI:188536063 GenBank AHD70052.1 472 Sequence 2141 from patent US 8586006
GI:188536063 GenBank AHD70053.1 472 Sequence 2142 from patent US 8586006
GI:188536063 GenBank AIC54142.1 472 CD36, partial [synthetic construct]
GI:188536063 RefSeq XP_005250771.1 472 PREDICTED: platelet glycoprotein 4 isoform X2 [Homo sapiens]
GI:188536063 RefSeq XP_005250772.1 472 PREDICTED: platelet glycoprotein 4 isoform X3 [Homo sapiens]

Related Sequences to LMP002284 proteins

Reference Database Accession Length Protein Name
GI:188536063 DBBJ BAG53380.1 472 unnamed protein product [Homo sapiens]
GI:583966140 DBBJ BAJ20339.1 472 CD36 molecule, partial [synthetic construct]
GI:583966144 DBBJ BAJ20339.1 472 CD36 molecule, partial [synthetic construct]
GI:583966144 DBBJ BAJ20339.1 472 CD36 molecule, partial [synthetic construct]
GI:188536063 GenBank AAA16068.1 472 antigen CD36 [Homo sapiens]
GI:188536063 GenBank ADA28899.1 471 Sequence 82 from patent US 7611703
GI:188536063 GenBank ADI80541.1 472 platelet glycoprotein IV variant [Homo sapiens]
GI:583966144 GenBank ADT48221.1 472 Sequence 238 from patent US 7842467
GI:583966140 GenBank ADT48221.1 472 Sequence 238 from patent US 7842467
GI:583966144 GenBank ADT48221.1 472 Sequence 238 from patent US 7842467
GI:583966144 GenBank ADT48222.1 472 Sequence 239 from patent US 7842467
GI:583966144 GenBank ADT48222.1 472 Sequence 239 from patent US 7842467
GI:583966140 GenBank ADT48222.1 472 Sequence 239 from patent US 7842467
GI:583966144 GenBank ADT48223.1 472 Sequence 240 from patent US 7842467
GI:583966144 GenBank ADT48223.1 472 Sequence 240 from patent US 7842467
GI:583966140 GenBank ADT48223.1 472 Sequence 240 from patent US 7842467
GI:583966144 GenBank ADT48224.1 472 Sequence 241 from patent US 7842467
GI:583966140 GenBank ADT48224.1 472 Sequence 241 from patent US 7842467
GI:583966144 GenBank ADT48224.1 472 Sequence 241 from patent US 7842467
GI:583966140 GenBank ADT48225.1 472 Sequence 242 from patent US 7842467
GI:188536063 GenBank ADT48227.1 471 Sequence 244 from patent US 7842467
GI:188536063 GenBank JAA08227.1 472 CD36 molecule (thrombospondin receptor) [Pan troglodytes]
GI:583966144 RefSeq XP_009241356.1 412 PREDICTED: platelet glycoprotein 4 isoform X2 [Pongo abelii]
GI:583966144 RefSeq XP_009241356.1 412 PREDICTED: platelet glycoprotein 4 isoform X2 [Pongo abelii]