Gene/Proteome Database (LMPD)

LMPD ID
LMP002287
Gene ID
11810
Species
Mus musculus (Mouse)
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Gene Symbol
Apobec1
Synonyms
Cdar1
Alternate Names
C->U-editing enzyme APOBEC-1; apolipoprotein B editing complex 1
Chromosome
6
Map Location
6 F1|6 57.68 cM
EC Number
3.5.4.-

Proteins

C->U-editing enzyme APOBEC-1
Refseq ID NP_112436
Protein GI 13624299
UniProt ID P51908
mRNA ID NM_031159
Length 229
RefSeq Status VALIDATED
MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSVWRHTSQNTSNHVEVNFLEKFTTERYFRPNTRCSITWFLSWSPCGECSRAITEFLSRHPYVTLFIYIARLYHHTDQRNRQGLRDLISSGVTIQIMTEQEYCYCWRNFVNYPPSNEAYWPRYPHLWVKLYVLELYCIILGLPPCLKILRRKQPQLTFFTITLQTCHYQRIPPHLLWATGLK
C->U-editing enzyme APOBEC-1
Refseq ID NP_001127863
Protein GI 197304695
UniProt ID P51908
mRNA ID NM_001134391
Length 229
RefSeq Status VALIDATED
Protein sequence is identical to GI:13624299 (mRNA isoform)

Gene Information

Entrez Gene ID
11810
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Gene Symbol
Apobec1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 ISS:UniProtKB C cytoplasm
GO:0017091 IDA:MGI F AU-rich element binding
GO:0016814 IEA:InterPro F hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
GO:0008270 IEA:InterPro F zinc ion binding
GO:0080111 IDA:UniProtKB P DNA demethylation
GO:0032869 IEA:Ensembl P cellular response to insulin stimulus
GO:0016554 IMP:MGI P cytidine to uridine editing
GO:0051607 IEA:Ensembl P defense response to virus
GO:0042158 IGI:MGI P lipoprotein biosynthetic process
GO:0042157 IMP:MGI P lipoprotein metabolic process
GO:0042953 IGI:MGI P lipoprotein transport
GO:0016556 IMP:MGI P mRNA modification
GO:0006397 IEA:UniProtKB-KW P mRNA processing
GO:0048255 IDA:MGI P mRNA stabilization
GO:0090310 IMP:UniProtKB P negative regulation of methylation-dependent chromatin silencing
GO:0042127 IGI:MGI P regulation of cell proliferation
GO:0051592 IEA:Ensembl P response to calcium ion
GO:0042493 IEA:Ensembl P response to drug
GO:0045471 IEA:Ensembl P response to ethanol
GO:0010332 IMP:MGI P response to gamma radiation
GO:0006970 IEA:Ensembl P response to osmotic stress
GO:0010043 IEA:Ensembl P response to zinc ion

BIOCYC Pathway Links

BIOCYC Pathway ID Description
DRIBOPMET-PWY (deoxy)ribose phosphate degradation
PWY0-1298 pyrimidine deoxyribonucleosides degradation
PWY-6556 pyrimidine ribonucleosides degradation II

REACTOME Pathway Links

REACTOME Pathway ID Description
5893021 Formation of the Editosome

Domain Information

InterPro Annotations

Accession Description
IPR007904 APOBEC-like, C-terminal
IPR016192 APOBEC/CMP deaminase, zinc-binding
IPR016193 Cytidine_deaminase-like

UniProt Annotations

Entry Information

Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Protein Entry
ABEC1_MOUSE
UniProt ID
P51908
Species
Mouse

Comments

Comment Type Description
Cofactor Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250};
Function Catalytic component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in the APOB mRNA. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. {ECO:0000269|PubMed:21496894}.
Similarity Belongs to the cytidine and deoxycytidylate deaminase family. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000250}.
Subunit Homodimer. Part of the apolipoprotein B mRNA editing complex with APC. Interacts with HNRPAB and SYNCRIP (By similarity). {ECO:0000250}.
Tissue Specificity Expressed in the spleen. Expressed at lower level in the kidney, testis, lung, brain and liver. {ECO:0000269|PubMed:12859895}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002287 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13624299 RefSeq NP_112436 229 C->U-editing enzyme APOBEC-1

Identical Sequences to LMP002287 proteins

Reference Database Accession Length Protein Name
GI:13624299 GenBank EDK99689.1 229 apolipoprotein B editing complex 1, isoform CRA_a [Mus musculus]
GI:13624299 GenBank EDK99691.1 229 apolipoprotein B editing complex 1, isoform CRA_a [Mus musculus]
GI:13624299 GenBank ABZ23586.1 229 Sequence 36 from patent US 7314621
GI:13624299 RefSeq NP_001127863.1 229 C->U-editing enzyme APOBEC-1 [Mus musculus]
GI:13624299 RefSeq XP_006505463.1 229 PREDICTED: C->U-editing enzyme APOBEC-1 isoform X1 [Mus musculus]
GI:13624299 RefSeq XP_006505464.1 229 PREDICTED: C->U-editing enzyme APOBEC-1 isoform X2 [Mus musculus]

Related Sequences to LMP002287 proteins

Reference Database Accession Length Protein Name
GI:13624299 DBBJ BAE38760.1 229 unnamed protein product [Mus musculus]
GI:13624299 GenBank AAH03792.1 229 Apobec1 protein [Mus musculus]
GI:13624299 GenBank EDK99690.1 240 apolipoprotein B editing complex 1, isoform CRA_b, partial [Mus musculus]
GI:13624299 PIR - 229 apolipoprotein B mRNA editing enzyme, catalytic chain 1 (EC 3.5.4.-) - mouse [Mus musculus]
GI:13624299 PRF - 229 apolipoprotein B [Mus musculus]
GI:13624299 SwissProt P38483.1 229 RecName: Full=C->U-editing enzyme APOBEC-1; AltName: Full=Apolipoprotein B mRNA-editing enzyme 1 [Rattus norvegicus]