LIPID MAPS

LMPD ID

LMP002303

Gene ID

11815

Species

Mus musculus (Mouse)

Gene Name

apolipoprotein D

Gene Symbol

Apod

Synonyms

-

Chromosome

16

Map Location

16 B2|16 21.41 cM

Summary

The protein encoded by this gene is a component of high-density lipoprotein (HDL), but is unique in that it shares greater structural similarity to lipocalin than to other members of the apolipoprotein family, and has a wider tissue expression pattern. The encoded protein is involved in lipid metabolism, and ablation of this gene results in defects in triglyceride metabolism. Elevated levels of this gene product have been observed in multiple tissues of Niemann-Pick disease mouse models, as well as in some tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]

Orthologs

View orthologs and multiple alignments for Apod

apolipoprotein D precursor
Refseq ID	NP_001288282
Protein GI	672424479
UniProt ID	P51910
mRNA ID	NM_001301353
Length	189
RefSeq Status	REVIEWED
MVTMLMFLATLAGLFTTAKGQNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL

apolipoprotein D precursor
Refseq ID	NP_001288283
Protein GI	672424481
UniProt ID	P51910
mRNA ID	NM_001301354
Length	189
RefSeq Status	REVIEWED
Protein sequence is identical to GI:672424479 (mRNA isoform)

apolipoprotein D precursor
Refseq ID	NP_031496
Protein GI	75677437
UniProt ID	P51910
mRNA ID	NM_007470
Length	189
RefSeq Status	REVIEWED
Protein sequence is identical to GI:672424479 (mRNA isoform)
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL

Entrez Gene ID

11815

Gene Name

apolipoprotein D

Gene Symbol

Apod

Species

Mus musculus

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0022626	ISS:UniProtKB	C	cytosolic ribosome
GO:0030425	ISS:UniProtKB	C	dendrite
GO:0005783	ISS:UniProtKB	C	endoplasmic reticulum
GO:0005615	ISS:UniProtKB	C	extracellular space
GO:0070062	IEA:Ensembl	C	extracellular vesicular exosome
GO:0005622	IDA:MGI	C	intracellular
GO:0043025	ISS:UniProtKB	C	neuronal cell body
GO:0048471	ISS:UniProtKB	C	perinuclear region of cytoplasm
GO:0015485	ISS:UniProtKB	F	cholesterol binding
GO:0005215	IEA:InterPro	F	transporter activity
GO:0007568	ISS:UniProtKB	P	aging
GO:0007420	ISS:UniProtKB	P	brain development
GO:0006006	ISS:UniProtKB	P	glucose metabolic process
GO:0006629	ISS:UniProtKB	P	lipid metabolic process
GO:2000405	ISS:UniProtKB	P	negative regulation of T cell migration
GO:1900016	ISS:UniProtKB	P	negative regulation of cytokine production involved in inflammatory response
GO:0051895	ISS:UniProtKB	P	negative regulation of focal adhesion assembly
GO:0060588	IMP:UniProtKB	P	negative regulation of lipoprotein lipid oxidation
GO:0071638	ISS:UniProtKB	P	negative regulation of monocyte chemotactic protein-1 production
GO:0010642	ISS:UniProtKB	P	negative regulation of platelet-derived growth factor receptor signaling pathway
GO:0042308	ISS:UniProtKB	P	negative regulation of protein import into nucleus
GO:0048662	ISS:UniProtKB	P	negative regulation of smooth muscle cell proliferation
GO:2000098	ISS:UniProtKB	P	negative regulation of smooth muscle cell-matrix adhesion
GO:0014012	ISS:UniProtKB	P	peripheral nervous system axon regeneration
GO:0048678	ISS:UniProtKB	P	response to axon injury
GO:0042493	ISS:UniProtKB	P	response to drug
GO:0000302	IMP:UniProtKB	P	response to reactive oxygen species
GO:0042246	ISS:UniProtKB	P	tissue regeneration

InterPro Annotations

Accession	Description
IPR002969	Apolipoprotein D
IPR026222	Apolipoprotein D, vertebrates
IPR012674	Calycin
IPR011038	Calycin-like
IPR002345	Lipocalin
IPR022272	Lipocalin family conserved site
IPR022271	Lipocalin, ApoD type
IPR000566	Lipocalin/cytosolic fatty-acid binding domain

Entry Information

Gene Name

apolipoprotein D

Protein Entry

P51910_MOUSE

UniProt ID

P51910

Species

Mouse

Comments

Comment Type	Description
Function	APOD occurs in the macromolecular complex with lecithin- transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.
Similarity	Belongs to the calycin superfamily. Lipocalin family. {ECO:0000305}.
Subcellular Location	Secreted.
Subunit	Homodimer. {ECO:0000250}.
Tissue Specificity	Highest levels of expression in brain, testis, virgin mammary gland and salivary gland. Moderate levels in skeletal muscle, lactating mammary gland and thymus. Low levels in lung and lymph node. No expression in kidney, pancreas, liver or spleen.