Gene/Proteome Database (LMPD)

LMPD ID
LMP002303
Gene ID
Species
Mus musculus (Mouse)
Gene Name
apolipoprotein D
Gene Symbol
Synonyms
-
Chromosome
16
Map Location
16 B2|16 21.41 cM
Summary
The protein encoded by this gene is a component of high-density lipoprotein (HDL), but is unique in that it shares greater structural similarity to lipocalin than to other members of the apolipoprotein family, and has a wider tissue expression pattern. The encoded protein is involved in lipid metabolism, and ablation of this gene results in defects in triglyceride metabolism. Elevated levels of this gene product have been observed in multiple tissues of Niemann-Pick disease mouse models, as well as in some tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
Orthologs

Proteins

apolipoprotein D precursor
Refseq ID NP_001288282
Protein GI 672424479
UniProt ID P51910
mRNA ID NM_001301353
Length 189
RefSeq Status REVIEWED
MVTMLMFLATLAGLFTTAKGQNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL
apolipoprotein D precursor
Refseq ID NP_001288283
Protein GI 672424481
UniProt ID P51910
mRNA ID NM_001301354
Length 189
RefSeq Status REVIEWED
Protein sequence is identical to GI:672424479 (mRNA isoform)
apolipoprotein D precursor
Refseq ID NP_031496
Protein GI 75677437
UniProt ID P51910
mRNA ID NM_007470
Length 189
RefSeq Status REVIEWED
Protein sequence is identical to GI:672424479 (mRNA isoform)
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL

Gene Information

Entrez Gene ID
Gene Name
apolipoprotein D
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0022626 ISS:UniProtKB C cytosolic ribosome
GO:0030425 ISS:UniProtKB C dendrite
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0005615 ISS:UniProtKB C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005622 IDA:MGI C intracellular
GO:0043025 ISS:UniProtKB C neuronal cell body
GO:0048471 ISS:UniProtKB C perinuclear region of cytoplasm
GO:0015485 ISS:UniProtKB F cholesterol binding
GO:0005215 IEA:InterPro F transporter activity
GO:0007568 ISS:UniProtKB P aging
GO:0007420 ISS:UniProtKB P brain development
GO:0006006 ISS:UniProtKB P glucose metabolic process
GO:0006629 ISS:UniProtKB P lipid metabolic process
GO:2000405 ISS:UniProtKB P negative regulation of T cell migration
GO:1900016 ISS:UniProtKB P negative regulation of cytokine production involved in inflammatory response
GO:0051895 ISS:UniProtKB P negative regulation of focal adhesion assembly
GO:0060588 IMP:UniProtKB P negative regulation of lipoprotein lipid oxidation
GO:0071638 ISS:UniProtKB P negative regulation of monocyte chemotactic protein-1 production
GO:0010642 ISS:UniProtKB P negative regulation of platelet-derived growth factor receptor signaling pathway
GO:0042308 ISS:UniProtKB P negative regulation of protein import into nucleus
GO:0048662 ISS:UniProtKB P negative regulation of smooth muscle cell proliferation
GO:2000098 ISS:UniProtKB P negative regulation of smooth muscle cell-matrix adhesion
GO:0014012 ISS:UniProtKB P peripheral nervous system axon regeneration
GO:0048678 ISS:UniProtKB P response to axon injury
GO:0042493 ISS:UniProtKB P response to drug
GO:0000302 IMP:UniProtKB P response to reactive oxygen species
GO:0042246 ISS:UniProtKB P tissue regeneration

Domain Information

InterPro Annotations

Accession Description
IPR002969 Apolipoprotein D
IPR026222 Apolipoprotein D, vertebrates
IPR012674 Calycin
IPR011038 Calycin-like
IPR002345 Lipocalin
IPR022272 Lipocalin family conserved site
IPR022271 Lipocalin, ApoD type
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
apolipoprotein D
Protein Entry
P51910_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function APOD occurs in the macromolecular complex with lecithin- transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.
Similarity Belongs to the calycin superfamily. Lipocalin family. {ECO:0000305}.
Subcellular Location Secreted.
Subunit Homodimer. {ECO:0000250}.
Tissue Specificity Highest levels of expression in brain, testis, virgin mammary gland and salivary gland. Moderate levels in skeletal muscle, lactating mammary gland and thymus. Low levels in lung and lymph node. No expression in kidney, pancreas, liver or spleen.

Identical and Related Proteins

Unique RefSeq proteins for LMP002303 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
672424479 RefSeq NP_001288282 189 apolipoprotein D precursor

Identical Sequences to LMP002303 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP002303 proteins

Reference Database Accession Length Protein Name