Gene/Proteome Database (LMPD)
LMPD ID
LMP002303
Gene ID
Species
Mus musculus (Mouse)
Gene Name
apolipoprotein D
Gene Symbol
Synonyms
-
Chromosome
16
Map Location
16 B2|16 21.41 cM
Summary
The protein encoded by this gene is a component of high-density lipoprotein (HDL), but is unique in that it shares greater structural similarity to lipocalin than to other members of the apolipoprotein family, and has a wider tissue expression pattern. The encoded protein is involved in lipid metabolism, and ablation of this gene results in defects in triglyceride metabolism. Elevated levels of this gene product have been observed in multiple tissues of Niemann-Pick disease mouse models, as well as in some tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
Orthologs
Proteins
| apolipoprotein D precursor | |
|---|---|
| Refseq ID | NP_001288282 |
| Protein GI | 672424479 |
| UniProt ID | P51910 |
| mRNA ID | NM_001301353 |
| Length | 189 |
| RefSeq Status | REVIEWED |
| MVTMLMFLATLAGLFTTAKGQNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL | |
| apolipoprotein D precursor | |
|---|---|
| Refseq ID | NP_001288283 |
| Protein GI | 672424481 |
| UniProt ID | P51910 |
| mRNA ID | NM_001301354 |
| Length | 189 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:672424479 (mRNA isoform) | |
| apolipoprotein D precursor | |
|---|---|
| Refseq ID | NP_031496 |
| Protein GI | 75677437 |
| UniProt ID | P51910 |
| mRNA ID | NM_007470 |
| Length | 189 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:672424479 (mRNA isoform) | |
| sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0022626 | ISS:UniProtKB | C | cytosolic ribosome |
| GO:0030425 | ISS:UniProtKB | C | dendrite |
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0005615 | ISS:UniProtKB | C | extracellular space |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005622 | IDA:MGI | C | intracellular |
| GO:0043025 | ISS:UniProtKB | C | neuronal cell body |
| GO:0048471 | ISS:UniProtKB | C | perinuclear region of cytoplasm |
| GO:0015485 | ISS:UniProtKB | F | cholesterol binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
| GO:0007568 | ISS:UniProtKB | P | aging |
| GO:0007420 | ISS:UniProtKB | P | brain development |
| GO:0006006 | ISS:UniProtKB | P | glucose metabolic process |
| GO:0006629 | ISS:UniProtKB | P | lipid metabolic process |
| GO:1900016 | ISS:UniProtKB | P | negative regulation of cytokine production involved in inflammatory response |
| GO:0051895 | ISS:UniProtKB | P | negative regulation of focal adhesion assembly |
| GO:0060588 | IMP:UniProtKB | P | negative regulation of lipoprotein lipid oxidation |
| GO:0071638 | ISS:UniProtKB | P | negative regulation of monocyte chemotactic protein-1 production |
| GO:0010642 | ISS:UniProtKB | P | negative regulation of platelet-derived growth factor receptor signaling pathway |
| GO:0042308 | ISS:UniProtKB | P | negative regulation of protein import into nucleus |
| GO:2000098 | ISS:UniProtKB | P | negative regulation of smooth muscle cell-matrix adhesion |
| GO:0048662 | ISS:UniProtKB | P | negative regulation of smooth muscle cell proliferation |
| GO:2000405 | ISS:UniProtKB | P | negative regulation of T cell migration |
| GO:0014012 | ISS:UniProtKB | P | peripheral nervous system axon regeneration |
| GO:0048678 | ISS:UniProtKB | P | response to axon injury |
| GO:0042493 | ISS:UniProtKB | P | response to drug |
| GO:0000302 | IMP:UniProtKB | P | response to reactive oxygen species |
| GO:0042246 | ISS:UniProtKB | P | tissue regeneration |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | APOD occurs in the macromolecular complex with lecithin- transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts. |
| Similarity | Belongs to the calycin superfamily. Lipocalin family. {ECO:0000305}. |
| Subcellular Location | Secreted. |
| Subunit | Homodimer. {ECO:0000250}. |
| Tissue Specificity | Highest levels of expression in brain, testis, virgin mammary gland and salivary gland. Moderate levels in skeletal muscle, lactating mammary gland and thymus. Low levels in lung and lymph node. No expression in kidney, pancreas, liver or spleen. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002303 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 672424479 | RefSeq | NP_001288282 | 189 | apolipoprotein D precursor |
Identical Sequences to LMP002303 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP002303 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|