Gene/Proteome Database (LMPD)
LMPD ID
LMP002325
Gene ID
Species
Homo sapiens (Human)
Gene Name
aldehyde dehydrogenase 1 family, member A1
Gene Symbol
Synonyms
ALDC; ALDH-E1; ALDH1; ALDH11; HEL-9; HEL-S-53e; HEL12; PUMB1; RALDH1
Alternate Names
retinal dehydrogenase 1; ALHDII; RALDH 1; ALDH class 1; acetaldehyde dehydrogenase 1; epididymis luminal protein 9; epididymis luminal protein 12; retinaldehyde dehydrogenase 1; aldehyde dehydrogenase 1, soluble; aldehyde dehydrogenase, liver cytosolic; epididymis secretory sperm binding protein Li 53e
Chromosome
9
Map Location
9q21.13
EC Number
1.2.1.36
Summary
The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet. [provided by RefSeq, Mar 2011]
Orthologs
Proteins
| retinal dehydrogenase 1 | |
|---|---|
| Refseq ID | NP_000680 |
| Protein GI | 21361176 |
| UniProt ID | P00352 |
| mRNA ID | NM_000689 |
| Length | 501 |
| RefSeq Status | REVIEWED |
| MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS | |
Gene Information
Entrez Gene ID
Gene Name
aldehyde dehydrogenase 1 family, member A1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | TAS:ProtInc | C | cytoplasm |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0005099 | TAS:UniProtKB | F | Ras GTPase activator activity |
| GO:0004029 | EXP:Reactome | F | aldehyde dehydrogenase (NAD) activity |
| GO:0005497 | TAS:ProtInc | F | androgen binding |
| GO:0001758 | IEA:UniProtKB-EC | F | retinal dehydrogenase activity |
| GO:0006081 | TAS:ProtInc | P | cellular aldehyde metabolic process |
| GO:0006069 | TAS:Reactome | P | ethanol oxidation |
| GO:0032320 | TAS:GOC | P | positive regulation of Ras GTPase activity |
| GO:0042572 | IEA:UniProtKB-UniPathway | P | retinol metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0006805 | TAS:Reactome | P | xenobiotic metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00830 | Retinol metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_34 | Ethanol oxidation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016162 | Aldehyde dehydrogenase N-terminal domain |
| IPR015590 | Aldehyde dehydrogenase domain |
| IPR016163 | Aldehyde dehydrogenase, C-terminal |
| IPR016160 | Aldehyde dehydrogenase, cysteine active site |
| IPR029510 | Aldehyde dehydrogenase, glutamic acid active site |
| IPR016161 | Aldehyde/histidinol dehydrogenase |
UniProt Annotations
Entry Information
Gene Name
aldehyde dehydrogenase 1 family, member A1
Protein Entry
AL1A1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Retinal + NAD(+) + H(2)O = retinoate + NADH. |
| Function | Binds free retinal and cellular retinol-binding protein- bound retinal. Can convert/oxidize retinaldehyde to retinoic acid (By similarity). |
| Pathway | Cofactor metabolism; retinol metabolism. |
| Similarity | Belongs to the aldehyde dehydrogenase family. |
| Subcellular Location | Cytoplasm. |
| Subunit | Homotetramer. |
| Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/aldh1a1/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002325 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 21361176 | RefSeq | NP_000680 | 501 | retinal dehydrogenase 1 |
Identical Sequences to LMP002325 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21361176 | GenBank | JAA16237.1 | 501 | aldehyde dehydrogenase 1 family, member A1 [Pan troglodytes] |
| GI:21361176 | GenBank | JAA30538.1 | 501 | aldehyde dehydrogenase 1 family, member A1 [Pan troglodytes] |
| GI:21361176 | GenBank | AGD90960.1 | 501 | Sequence 4 from patent US 8354435 |
| GI:21361176 | GenBank | AGM85141.1 | 501 | Sequence 4 from patent US 8389522 |
| GI:21361176 | GenBank | AHD63009.1 | 501 | Sequence 46 from patent US 8580523 |
| GI:21361176 | GenBank | AIC48245.1 | 501 | ALDH1A1, partial [synthetic construct] |
Related Sequences to LMP002325 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21361176 | EMBL | CBN65635.1 | 502 | unnamed protein product [synthetic construct] |
| GI:21361176 | GenBank | AAP36480.1 | 502 | Homo sapiens aldehyde dehydrogenase 1 family, member A1, partial [synthetic construct] |
| GI:21361176 | GenBank | AAX29607.1 | 502 | aldehyde dehydrogenase 1 family member A1, partial [synthetic construct] |
| GI:21361176 | GenBank | AAX29608.1 | 502 | aldehyde dehydrogenase 1 family member A1, partial [synthetic construct] |
| GI:21361176 | GenBank | AEN35189.1 | 500 | Sequence 1117 from patent US 7998689 |
| GI:21361176 | RefSeq | XP_004048178.1 | 501 | PREDICTED: retinal dehydrogenase 1 isoform 1 [Gorilla gorilla gorilla] |