Gene/Proteome Database (LMPD)
LMPD ID
LMP002333
Gene ID
Species
Homo sapiens (Human)
Gene Name
annexin A9
Gene Symbol
Synonyms
ANX31
Alternate Names
annexin A9; annexin-9; pemphaxin; annexin 31; annexin-31; annexin XXXI
Chromosome
1
Map Location
1q21
Summary
The annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
annexin A9 | |
---|---|
Refseq ID | NP_003559 |
Protein GI | 145864465 |
UniProt ID | O76027 |
mRNA ID | NM_003568 |
Length | 345 |
RefSeq Status | VALIDATED |
MSVTGGKMAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAEGPSREETWVPVFTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQVALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009986 | IDA:UniProtKB | C | cell surface |
GO:0005829 | IDA:UniProtKB | C | cytosol |
GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
GO:0015464 | IDA:UniProtKB | F | acetylcholine receptor activity |
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0005544 | IEA:InterPro | F | calcium-dependent phospholipid binding |
GO:0001786 | IDA:UniProtKB | F | phosphatidylserine binding |
GO:0005543 | IDA:UniProtKB | F | phospholipid binding |
GO:0042803 | TAS:UniProtKB | F | protein homodimerization activity |
GO:0016337 | IDA:UniProtKB | P | single organismal cell-cell adhesion |
GO:0007268 | IDA:GOC | P | synaptic transmission |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Low affinity receptor for acetylcholine known to be targeted by disease-causing pemphigus vulgaris antibodies in keratinocytes. |
Interaction | O60437:PPL; NbExp=6; IntAct=EBI-720960, EBI-368321; |
Sequence Caution | Sequence=AAH05830.2; Type=Erroneous initiation; Evidence= ; Sequence=CAA08933.1; Type=Frameshift; Positions=7; Evidence= ; |
Similarity | Belongs to the annexin family. |
Similarity | Contains 4 annexin repeats. |
Subunit | Homodimer. |
Tissue Specificity | Expressed in the stratified squamous skin epithelium, but not in epithelia of other types (at protein level). |
Identical and Related Proteins
Unique RefSeq proteins for LMP002333 (as displayed in Record Overview)
Identical Sequences to LMP002333 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:145864465 | EMBL | CCV20016.1 | 345 | unnamed protein product [Homo sapiens] |
GI:145864465 | GenBank | EAW53496.1 | 345 | annexin A9 [Homo sapiens] |
GI:145864465 | GenBank | ABM83945.1 | 345 | annexin A9 [synthetic construct] |
GI:145864465 | GenBank | ABM87263.1 | 345 | annexin A9, partial [synthetic construct] |
GI:145864465 | SwissProt | O76027.3 | 345 | RecName: Full=Annexin A9; AltName: Full=Annexin XXXI; AltName: Full=Annexin-31; AltName: Full=Annexin-9; AltName: Full=Pemphaxin [Homo sapiens] |
Related Sequences to LMP002333 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:145864465 | GenBank | AAG16780.1 | 345 | keratinocyte annexin-like protein pemphaxin [Homo sapiens] |
GI:145864465 | GenBank | AAP36855.1 | 346 | Homo sapiens annexin A9, partial [synthetic construct] |
GI:145864465 | GenBank | AAX29126.1 | 346 | annexin A9, partial [synthetic construct] |
GI:145864465 | GenBank | AAX29127.1 | 346 | annexin A9, partial [synthetic construct] |
GI:145864465 | RefSeq | XP_513782.2 | 345 | PREDICTED: annexin A9 isoform X2 [Pan troglodytes] |
GI:145864465 | RefSeq | XP_003817327.1 | 345 | PREDICTED: annexin A9 isoform X2 [Pan paniscus] |