Gene/Proteome Database (LMPD)
LMPD ID
LMP002356
Gene ID
Species
Mus musculus (Mouse)
Gene Name
dihydrolipoamide branched chain transacylase E2
Gene Symbol
Synonyms
D3Wsu60e
Alternate Names
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial; BCKADE2; BCKAD E2; BCKAD-E2; part of the BCKAD complex; dihydrolipoyl transacylase; branched-chain alpha-ketoacid dehydrogenase, E2 subunit; dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; branched-chain alpha-keto acid dehydrogenase complex component E2; dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
Chromosome
3
Map Location
3 G1|3 50.37 cM
EC Number
2.3.1.168
Proteins
| lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial | |
|---|---|
| Refseq ID | NP_034152 |
| Protein GI | 170172520 |
| UniProt ID | P53395 |
| mRNA ID | NM_010022 |
| Length | 482 |
| RefSeq Status | VALIDATED |
| MAAARVLRTWSQNAVRLTCVRYFQTFNSARVLKPKCVCSVGYPLFKYSQPRHSLRTAAVLQGQVVQFKLSDIGEGIREVTIKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKRLYYNLDDIAYVGKPLIDIETEALKDSEEDVVETPAVSHDEHTHQEIKGQKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILSFLEKQTGAILPPSPKSEITPPPPQPKDRTFPTPIAKPPVFTGKDRTEPVTGFQKAMVKTMSAALKIPHFGYCDEIDLTQLVKLREELKPVALARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTELGLIVPNVKNVQVRSVFEIAMELNRLQKLGSSGQLGTTDLTGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGAIKALPRFDQKGDVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK | |
| transit_peptide: 1..61 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (P53395.2) calculated_mol_wt: 6990 peptide sequence: MAAARVLRTWSQNAVRLTCVRYFQTFNSARVLKPKCVCSVGYPLFKYSQPRHSLRTAAVLQ mat_peptide: 62..482 product: Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P53395.2) calculated_mol_wt: 46275 peptide sequence: GQVVQFKLSDIGEGIREVTIKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKRLYYNLDDIAYVGKPLIDIETEALKDSEEDVVETPAVSHDEHTHQEIKGQKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILSFLEKQTGAILPPSPKSEITPPPPQPKDRTFPTPIAKPPVFTGKDRTEPVTGFQKAMVKTMSAALKIPHFGYCDEIDLTQLVKLREELKPVALARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTELGLIVPNVKNVQVRSVFEIAMELNRLQKLGSSGQLGTTDLTGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGAIKALPRFDQKGDVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK | |
Gene Information
Entrez Gene ID
Gene Name
dihydrolipoamide branched chain transacylase E2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0042645 | IEA:Ensembl | C | mitochondrial nucleoid |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0043754 | IEA:UniProtKB-EC | F | dihydrolipoyllysine-residue (2-methylpropanoyl)transferase activity |
BIOCYC Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5892792 | Branched-chain amino acid catabolism |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site |
| IPR001078 | 2-oxoacid dehydrogenase acyltransferase, catalytic domain |
| IPR000089 | Biotin/lipoyl attachment |
| IPR023213 | Chloramphenicol acetyltransferase-like domain |
| IPR004167 | E3-binding domain |
| IPR015761 | Lipoamide Acyltransferase |
| IPR011053 | Single hybrid motif |
UniProt Annotations
Entry Information
Gene Name
dihydrolipoamide branched chain transacylase E2
Protein Entry
ODB2_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2-methylpropanoyl-CoA + enzyme N(6)- (dihydrolipoyl)lysine = CoA + enzyme N(6)-(S-(2- methylpropanoyl)dihydrolipoyl)lysine. |
| Cofactor | Name=(R)-lipoate; Xref=ChEBI:CHEBI:83088; Evidence={ECO:0000250}; Note=Binds 1 lipoyl cofactor covalently. {ECO:0000250}; |
| Function | The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). Within this complex, the catalytic function of this enzyme is to accept, and to transfer to coenzyme A, acyl groups that are generated by the branched-chain alpha-keto acid decarboxylase component. |
| Similarity | Belongs to the 2-oxoacid dehydrogenase family. {ECO:0000305}. |
| Similarity | Contains 1 lipoyl-binding domain. {ECO:0000255|PROSITE-ProRule:PRU01066, ECO:0000305}. |
| Subcellular Location | Mitochondrion matrix. |
| Subunit | Forms a 24-polypeptide structural core with octahedral symmetry. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002356 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 170172520 | RefSeq | NP_034152 | 482 | lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial |
Identical Sequences to LMP002356 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:170172520 | DBBJ | BAE38487.1 | 482 | unnamed protein product [Mus musculus] |
| GI:170172520 | GenBank | EDL12381.1 | 482 | dihydrolipoamide branched chain transacylase E2 [Mus musculus] |
| GI:170172520 | SwissProt | P53395.2 | 482 | RecName: Full=Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial; AltName: Full=Branched-chain alpha-keto acid dehydrogenase complex component E2; Short=BCKAD-E2; Short=BCKADE2; AltName: Full=Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; AltName: Full=Dihydrolipoamide branched chain transacylase; AltName: Full=Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; Flags: Precursor [Mus musculus] |
Related Sequences to LMP002356 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:170172520 | GenBank | AAC37681.1 | 482 | acyltransferase [Mus musculus] |
| GI:170172520 | GenBank | AAH55890.1 | 482 | Dihydrolipoamide branched chain transacylase E2 [Mus musculus] |
| GI:170172520 | GenBank | AEU53496.1 | 482 | Sequence 127 from patent US 8062891 |
| GI:170172520 | GenBank | AGO72449.1 | 482 | Sequence 127 from patent US 8470972 |
| GI:170172520 | GenBank | AGU32440.1 | 482 | Sequence 127 from patent US 8507277 |
| GI:170172520 | PRF | - | 482 | branched chain alpha-ketoacid dehydrogenase:SUBUNIT=E2 [Mus musculus] |