Gene/Proteome Database (LMPD)
LMPD ID
LMP002399
Gene ID
Species
Mus musculus (Mouse)
Gene Name
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Gene Symbol
Synonyms
Fgs; Fs
Alternate Names
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1; forssman glycolipid synthase; forssman glycolipid synthetase
Chromosome
2
Map Location
2 A3|2
EC Number
2.4.1.88
Proteins
| globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 | |
|---|---|
| Refseq ID | NP_631936 |
| Protein GI | 254587968 |
| UniProt ID | Q8VI38 |
| mRNA ID | NM_139197 |
| Length | 347 |
| RefSeq Status | VALIDATED |
| MTRPRLAQGLAFFLLGGTGLWVLWKFIKDWLLVSYIPYYLPCPEFFNMKLPFRKEKPLQPVTQLQYPQPKLLEHGPTELLTLTPWLAPIVSEGTFDPELLKSMYQPLNLTIGVTVFAVGKYTCFIQRFLESAEEFFMRGYQVHYYLFTHDPTAVPRVPLGPGRLLSIIPIQGYSRWEEISMRRMETINKHIAKRAHKEVDYLFCVDVDMVFRNPWGPETLGDLVAAIHPGYFAVPRRKFPYERRQVSSAFVADNEGDFYYGGALFGGRVARVYEFTRACHMAILADKANSIMAAWQEESHLNRHFIWHKPSKVLSPEYLWDERKPRPRSLKMIRFSSVKKNANWLRT | |
Gene Information
Entrez Gene ID
Gene Name
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | TAS:UniProtKB | C | membrane |
| GO:0047277 | IDA:UniProtKB | F | globoside alpha-N-acetylgalactosaminyltransferase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0030259 | TAS:UniProtKB | P | lipid glycosylation |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Protein Entry
GBGT1_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-alpha-D-galactosamine + N-acetyl- D-galactosaminyl-(1->3)-D-galactosyl-(1->4)-D-galactosyl-(1->4)-D- glucosyl-(1<->1)-ceramide = UDP + N-acetyl-D-galactosaminyl- (1->3)-N-acetyl-D-galactosaminyl-(1->3)-D-galactosyl-(1->4)-D- galactosyl-(1->4)-D-glucosyl-(1<->1)-ceramide. |
| Cofactor | Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; |
| Domain | The conserved DXD motif is involved in cofactor binding. The manganese ion interacts with the beta-phosphate group of UDP and may also have a role in catalysis (By similarity). {ECO:0000250}. |
| Function | Catalyzes the formation of Forssman glycolipid via the addition of N-acetylgalactosamine (GalNAc) in alpha-1,3-linkage to GalNAcb-1,3Gala-1,4Galb-1,4GlcCer (Gb4Cer). Forssman glycolipid (also called Forssman antigen; FG) probably serves for adherence of some pathogens. Conversely, it diminishes Shiga toxins susceptibility. {ECO:0000269|PubMed:14573676}. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 6 family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1; URL="http://www.functionalglycomics.org/glycomics/search/jsp/landing.jsp?query=gt_mou_504"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002399 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 254587968 | RefSeq | NP_631936 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 |
Identical Sequences to LMP002399 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254587968 | GenBank | AAI06832.1 | 347 | Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Mus musculus] |
| GI:254587968 | GenBank | EDL08384.1 | 347 | globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Mus musculus] |
| GI:254587968 | RefSeq | XP_006497981.1 | 347 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X1 [Mus musculus] |
| GI:254587968 | RefSeq | XP_006497982.1 | 347 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X2 [Mus musculus] |
| GI:254587968 | RefSeq | XP_006497983.1 | 347 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X3 [Mus musculus] |
| GI:254587968 | SwissProt | Q8VI38.2 | 347 | RecName: Full=Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1; AltName: Full=Forssman glycolipid synthase [Mus musculus] |
Related Sequences to LMP002399 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254587968 | DBBJ | BAC23060.2 | 347 | forssman glycolipid synthetase [Mus musculus] |
| GI:254587968 | GenBank | AAL37034.1 | 347 | Forssman glycolipid synthetase [Mus musculus] |
| GI:254587968 | RefSeq | XP_005085473.1 | 346 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X1 [Mesocricetus auratus] |
| GI:254587968 | RefSeq | XP_005346253.1 | 347 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 [Microtus ochrogaster] |
| GI:254587968 | RefSeq | XP_006497985.1 | 300 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 isoform X5 [Mus musculus] |
| GI:254587968 | RefSeq | XP_006993161.1 | 347 | PREDICTED: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1-like [Peromyscus maniculatus bairdii] |