Gene/Proteome Database (LMPD)
LMPD ID
LMP002416
Gene ID
Species
Mus musculus (Mouse)
Gene Name
alkaline ceramidase 3
Gene Symbol
Synonyms
1110057L18Rik; 5430429L08Rik; AV015045; Phca
Alternate Names
alkaline ceramidase 3; aPHC; alkCDase 3; alkaline CDase 3; alkaline phytoceramidase; phytoceramidase, alkaline
Chromosome
7
Map Location
7 E2|7
EC Number
3.5.1.-
Proteins
| alkaline ceramidase 3 | |
|---|---|
| Refseq ID | NP_079684 |
| Protein GI | 84794581 |
| UniProt ID | Q9D099 |
| mRNA ID | NM_025408 |
| Length | 267 |
| RefSeq Status | VALIDATED |
| MAPAVDRKGYWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLEKRYIAAYLALTVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKTKSSINYHLLFTLFLYSLTVTTIYLKVKEPIFHQVMYGMLVFTLVLRSIYIVTWVYPWLRGLGYTSLTVFLLGFLLWNIDNIFCDSLRNFRKRVPPVLGVTTQFHAWWHILTGLGSYLHILFSLYTRTLYLRYRPKVKFLFGIWPAVMFEPQRKH | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:Ensembl | C | integral component of Golgi membrane |
| GO:0030176 | IEA:Ensembl | C | integral component of endoplasmic reticulum membrane |
| GO:0070774 | IEA:Ensembl | F | phytoceramidase activity |
| GO:0006672 | IEA:InterPro | P | ceramide metabolic process |
| GO:0071602 | IEA:Ensembl | P | phytosphingosine biosynthetic process |
| GO:0008284 | IEA:Ensembl | P | positive regulation of cell proliferation |
| GO:0046512 | IEA:Ensembl | P | sphingosine biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008901 | Ceramidase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Enzyme Regulation | Activated by Ca(2+) and inhibited by Zn(2+). {ECO:0000250}. |
| Function | Hydrolyzes only phytoceramide into phytosphingosine and free fatty acid. Does not have reverse activity (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the alkaline ceramidase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002416 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 84794581 | RefSeq | NP_079684 | 267 | alkaline ceramidase 3 |
Identical Sequences to LMP002416 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:84794581 | DBBJ | BAB27768.1 | 267 | unnamed protein product [Mus musculus] |
| GI:84794581 | DBBJ | BAC38101.1 | 267 | unnamed protein product [Mus musculus] |
| GI:84794581 | DBBJ | BAE29719.1 | 267 | unnamed protein product [Mus musculus] |
| GI:84794581 | DBBJ | BAE36897.1 | 267 | unnamed protein product [Mus musculus] |
| GI:84794581 | GenBank | EDL16337.1 | 267 | phytoceramidase, alkaline, isoform CRA_b [Mus musculus] |
| GI:84794581 | SwissProt | Q9D099.1 | 267 | RecName: Full=Alkaline ceramidase 3; Short=AlkCDase 3; Short=Alkaline CDase 3; AltName: Full=Alkaline phytoceramidase; Short=aPHC [Mus musculus] |
Related Sequences to LMP002416 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:84794581 | DBBJ | BAB23250.1 | 267 | unnamed protein product [Mus musculus] |
| GI:84794581 | GenBank | EDM18447.1 | 267 | similar to Alkaline phytoceramidase (aPHC) (Alkaline ceramidase) (predicted), isoform CRA_b [Rattus norvegicus] |
| GI:84794581 | RefSeq | XP_001065019.2 | 267 | PREDICTED: alkaline ceramidase 3 [Rattus norvegicus] |
| GI:84794581 | RefSeq | XP_005074015.1 | 267 | PREDICTED: alkaline ceramidase 3 [Mesocricetus auratus] |
| GI:84794581 | RefSeq | XP_005357593.1 | 267 | PREDICTED: alkaline ceramidase 3 [Microtus ochrogaster] |
| GI:84794581 | RefSeq | XP_008758031.1 | 267 | PREDICTED: alkaline ceramidase 3 [Rattus norvegicus] |