Gene/Proteome Database (LMPD)

LMPD ID
LMP002420
Gene ID
6916
Species
Homo sapiens (Human)
Gene Name
thromboxane A synthase 1 (platelet)
Gene Symbol
TBXAS1
Synonyms
BDPLT14; CYP5; CYP5A1; GHOSAL; THAS; TS; TXAS; TXS
Alternate Names
thromboxane-A synthase; TXA synthase; cytochrome P450 5A1; platelet, cytochrome P450, subfamily V; cytochrome P450, family 5, subfamily A, polypeptide 1
Chromosome
7
Map Location
7q34-q35
EC Number
5.3.99.5
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Orthologs
View orthologs and multiple alignments for TBXAS1

Proteins

thromboxane-A synthase isoform 1
Refseq ID NP_001124438
Protein GI 195972896
UniProt ID P24557
mRNA ID NM_001130966
Length 534
RefSeq Status REVIEWED
MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR
thromboxane-A synthase isoform 1
Refseq ID NP_001052
Protein GI 195972898
UniProt ID P24557
mRNA ID NM_001061
Length 534
RefSeq Status REVIEWED
Protein sequence is identical to GI:195972896 (mRNA isoform)
thromboxane-A synthase isoform 2
Refseq ID NP_112246
Protein GI 195972900
UniProt ID P24557
mRNA ID NM_030984
Length 460
RefSeq Status REVIEWED
MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERYRCS
thromboxane-A synthase isoform 3
Refseq ID NP_001159725
Protein GI 261278370
UniProt ID P24557
mRNA ID NM_001166253
Length 580
RefSeq Status REVIEWED
MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALMSAFSPEKLNELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFCMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR
thromboxane-A synthase isoform 4
Refseq ID NP_001159726
Protein GI 261278372
UniProt ID P24557
mRNA ID NM_001166254
Length 466
RefSeq Status REVIEWED
MELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR

Gene Information

Entrez Gene ID
6916
Gene Name
thromboxane A synthase 1 (platelet)
Gene Symbol
TBXAS1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 IEA:UniProtKB-KW F monooxygenase activity
GO:0016705 IEA:InterPro F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004796 IEA:UniProtKB-EC F thromboxane-A synthase activity
GO:0019369 TAS:Reactome P arachidonic acid metabolic process
GO:0030644 IEA:Ensembl P cellular chloride ion homeostasis
GO:0019371 TAS:Reactome P cyclooxygenase pathway
GO:0006690 TAS:Reactome P icosanoid metabolic process
GO:0045907 IEA:Ensembl P positive regulation of vasoconstriction
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0006805 TAS:Reactome P xenobiotic metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04611 Platelet activation

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_150149 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
thromboxane A synthase 1 (platelet)
Protein Entry
THAS_HUMAN
UniProt ID
P24557
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P24557-1; Sequence=Displayed; Name=2; IsoId=P24557-2; Sequence=VSP_047217; Note=No experimental confirmation available.; Name=3; IsoId=P24557-3; Sequence=VSP_054121; Name=4; IsoId=P24557-4; Sequence=VSP_054122, VSP_054123;
Catalytic Activity (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-9-alpha,11-alpha- epoxy-15-hydroxythromboxa-5,13-dienoate.
Caution It is uncertain whether Met-1 is the initiator. An alternative upstream Met is found in primates, but not in other mammals.
Cofactor Name=heme; Xref=ChEBI
Disease Ghosal hematodiaphyseal dysplasia (GHDD) [MIM
Disease Note=Thromboxane synthetase deficiency has been detected in some patients with a bleeding disorder due to platelet dysfunction.
Sequence Caution Sequence=AAA60617.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAA60618.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAC01761.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=AAC01761.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99269.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99270.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99271.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99272.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99273.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99274.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99275.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99276.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99277.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99278.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAF99279.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAH41157.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=BAG58828.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=EAW83934.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ;
Similarity Belongs to the cytochrome P450 family.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Subunit Monomer.
Tissue Specificity Platelets, lung, kidney, spleen, macrophages and lung fibroblasts.
Web Resource Name=Cytochrome P450 Allele Nomenclature Committee; Note=CYP5A1 alleles; URL="http://www.cypalleles.ki.se/cyp5a1.htm";

Identical and Related Proteins

Unique RefSeq proteins for LMP002420 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
195972896 RefSeq NP_001124438 534 thromboxane-A synthase isoform 1
195972900 RefSeq NP_112246 460 thromboxane-A synthase isoform 2
261278370 RefSeq NP_001159725 580 thromboxane-A synthase isoform 3
261278372 RefSeq NP_001159726 466 thromboxane-A synthase isoform 4

Identical Sequences to LMP002420 proteins

Reference Database Accession Length Protein Name
GI:261278370 DBBJ BAG58828.1 580 unnamed protein product [Homo sapiens]
GI:195972896 DBBJ BAJ20885.1 534 thromboxane A synthase 1, partial [synthetic construct]
GI:261278372 GenBank AAH14117.1 466 TBXAS1 protein [Homo sapiens]
GI:261278372 GenBank EAW83934.1 466 hCG2044058 [Homo sapiens]
GI:195972896 GenBank EAW83935.1 534 hCG14925, isoform CRA_a [Homo sapiens]
GI:195972900 GenBank EAW83936.1 460 hCG14925, isoform CRA_b [Homo sapiens]
GI:195972896 GenBank ABY14916.1 534 Sequence 291 from patent US 7306913
GI:195972896 GenBank ABY14917.1 534 Sequence 292 from patent US 7306913
GI:195972900 GenBank ABY14918.1 460 Sequence 293 from patent US 7306913
GI:261278372 GenBank ADQ31780.1 466 thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), partial [synthetic construct]
GI:195972896 GenBank AED45728.1 534 Sequence 2004 from patent US 7892730
GI:261278372 GenBank AIC49841.1 466 TBXAS1, partial [synthetic construct]
GI:195972896 RefSeq NP_001052.2 534 thromboxane-A synthase isoform 1 [Homo sapiens]

Related Sequences to LMP002420 proteins

Reference Database Accession Length Protein Name
GI:195972900 GenBank AAA60617.1 460 thromboxane synthase [Homo sapiens]
GI:195972896 GenBank AAF99269.1 534 thromboxane synthase [Homo sapiens]
GI:195972896 GenBank AAF99270.1 534 thromboxane synthase [Homo sapiens]
GI:195972896 GenBank AAF99271.1 534 thromboxane synthase [Homo sapiens]
GI:261278372 GenBank AAH41157.1 534 Thromboxane A synthase 1 (platelet) [Homo sapiens]
GI:195972900 GenBank AAH41157.1 534 Thromboxane A synthase 1 (platelet) [Homo sapiens]
GI:261278372 GenBank EAW83935.1 534 hCG14925, isoform CRA_a [Homo sapiens]
GI:195972900 GenBank EAW83935.1 534 hCG14925, isoform CRA_a [Homo sapiens]
GI:261278372 GenBank ABY14916.1 534 Sequence 291 from patent US 7306913
GI:261278372 GenBank ABY14917.1 534 Sequence 292 from patent US 7306913
GI:195972896 GenBank ACM85663.1 554 Sequence 11161 from patent US 6812339
GI:195972896 GenBank ACM85664.1 554 Sequence 11162 from patent US 6812339
GI:261278372 GenBank AED45728.1 534 Sequence 2004 from patent US 7892730
GI:195972900 GenBank AED45728.1 534 Sequence 2004 from patent US 7892730
GI:261278370 GenBank EHH17731.1 580 hypothetical protein EGK_14193 [Macaca mulatta]
GI:195972900 GenBank AFD45262.1 460 Sequence 255 from patent US 8129114
GI:195972896 GenBank AHD76432.1 534 Sequence 19705 from patent US 8586006
GI:195972900 GenBank AHD76433.1 460 Sequence 19706 from patent US 8586006
GI:261278372 RefSeq NP_001124438.1 534 thromboxane-A synthase isoform 1 [Homo sapiens]
GI:261278370 RefSeq XP_002803529.1 580 PREDICTED: thromboxane-A synthase [Macaca mulatta]
GI:261278370 RefSeq XP_003270853.1 580 PREDICTED: thromboxane-A synthase isoform 2 [Nomascus leucogenys]
GI:261278370 RefSeq XP_003318881.1 580 PREDICTED: thromboxane-A synthase isoform X5 [Pan troglodytes]
GI:261278370 RefSeq XP_005550979.1 580 PREDICTED: thromboxane-A synthase isoform X1 [Macaca fascicularis]
GI:261278370 RefSeq XP_007981327.1 580 PREDICTED: thromboxane-A synthase isoform X8 [Chlorocebus sabaeus]