Gene/Proteome Database (LMPD)
LMPD ID
LMP002437
Gene ID
Species
Homo sapiens (Human)
Gene Name
cellular retinoic acid binding protein 2
Gene Symbol
Synonyms
CRABP-II; RBP6
Alternate Names
cellular retinoic acid-binding protein 2; cellular retinoic acid-binding protein II
Chromosome
1
Map Location
1q21.3
Summary
This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010]
Orthologs
Proteins
| cellular retinoic acid-binding protein 2 | |
|---|---|
| Refseq ID | NP_001186652 |
| Protein GI | 315013542 |
| UniProt ID | P29373 |
| mRNA ID | NM_001199723 |
| Length | 138 |
| RefSeq Status | REVIEWED |
| MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE | |
Gene Information
Entrez Gene ID
Gene Name
cellular retinoic acid binding protein 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:HPA | C | cytoplasm |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0005634 | IDA:HPA | C | nucleus |
| GO:0016918 | IEA:UniProtKB-KW | F | retinal binding |
| GO:0005501 | TAS:ProtInc | F | retinoid binding |
| GO:0019841 | IEA:UniProtKB-KW | F | retinol binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
| GO:0008544 | TAS:ProtInc | P | epidermis development |
| GO:0006355 | TAS:ProtInc | P | regulation of transcription, DNA-templated |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_11082 | Import of palmitoyl-CoA into the mitochondrial matrix |
| REACT_2071 | Pyruvate metabolism |
| REACT_12528 | Regulation of pyruvate dehydrogenase (PDH) complex |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cellular retinoic acid binding protein 2
Protein Entry
RABP2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Domain | Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. |
| Function | Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors. |
| Induction | By retinoic acid. |
| Ptm | Sumoylated in response to retinoic acid binding, sumoylation is critical for dissociation from ER and subsequent nuclear translocation. |
| Similarity | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Subcellular Location | Cytoplasm. Endoplasmic reticulum. Nucleus. Note=Upon ligand binding, a conformation change exposes a nuclear localization motif and the protein is transported into the nucleus. |
| Subunit | Interacts with RXR and RARA (By similarity). Interacts with importin alpha. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP002437 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 315013542 | RefSeq | NP_001186652 | 138 | cellular retinoic acid-binding protein 2 |
Identical Sequences to LMP002437 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:315013542 | GenBank | JAA18477.1 | 138 | cellular retinoic acid binding protein 2 [Pan troglodytes] |
| GI:315013542 | GenBank | JAA27864.1 | 138 | cellular retinoic acid binding protein 2 [Pan troglodytes] |
| GI:315013542 | GenBank | JAA39953.1 | 138 | cellular retinoic acid binding protein 2 [Pan troglodytes] |
| GI:315013542 | GenBank | AGA37081.1 | 138 | Sequence 163 from patent US 8314221 |
| GI:315013542 | GenBank | AHD72581.1 | 138 | Sequence 9649 from patent US 8586006 |
| GI:315013542 | RefSeq | XP_006711232.1 | 138 | PREDICTED: cellular retinoic acid-binding protein 2 isoform X1 [Homo sapiens] |
Related Sequences to LMP002437 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:315013542 | GenBank | AAV38629.1 | 139 | cellular retinoic acid binding protein 2, partial [synthetic construct] |
| GI:315013542 | GenBank | AAX43256.1 | 139 | cellular retinoic acid binding protein 2, partial [synthetic construct] |
| GI:315013542 | GenBank | AAX43288.1 | 139 | cellular retinoic acid binding protein 2, partial [synthetic construct] |
| GI:315013542 | RefSeq | XP_003259518.1 | 138 | PREDICTED: cellular retinoic acid-binding protein 2 isoform 2 [Nomascus leucogenys] |
| GI:315013542 | RefSeq | XP_004089897.1 | 138 | PREDICTED: cellular retinoic acid-binding protein 2 [Nomascus leucogenys] |
| GI:315013542 | RefSeq | XP_004089898.1 | 138 | PREDICTED: cellular retinoic acid-binding protein 2 [Nomascus leucogenys] |