Gene/Proteome Database (LMPD)

LMPD ID
LMP002445
Gene ID
Species
Mus musculus (Mouse)
Gene Name
lysophosphatidic acid receptor 2
Gene Symbol
Synonyms
Edg4; IPA2; LPA2
Chromosome
8
Map Location
8 B3.3|8 33.91 cM

Proteins

lysophosphatidic acid receptor 2
Refseq ID NP_064412
Protein GI 40254539
UniProt ID Q6P290
mRNA ID NM_020028
Length 348
RefSeq Status VALIDATED
MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYLLGNLAAADLFAGMAYLFLMFHTGPRTARLSIKGWFLRQGLLDTSLTASVATLLAIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVPLFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTVVIILGAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMRRTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL

Gene Information

Entrez Gene ID
Gene Name
lysophosphatidic acid receptor 2
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009986 IEA:Ensembl C cell surface
GO:0030139 IEA:Ensembl C endocytic vesicle
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0030165 IPI:MGI F PDZ domain binding
GO:0070915 IEA:InterPro F lysophosphatidic acid receptor activity
GO:0007186 IDA:MGI P G-protein coupled receptor signaling pathway
GO:0000187 IDA:MGI P activation of MAPK activity
GO:0043410 IDA:MGI P positive regulation of MAPK cascade
GO:0035025 IDA:MGI P positive regulation of Rho protein signal transduction

Domain Information

InterPro Annotations

Accession Description
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR004065 Lysophosphatidic acid receptor
IPR004066 Lysophosphatidic acid receptor EDG-4

UniProt Annotations

Entry Information

Gene Name
lysophosphatidic acid receptor 2
Protein Entry
Q6P290_MOUSE
UniProt ID
Species
Mouse

Identical and Related Proteins

Unique RefSeq proteins for LMP002445 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
40254539 RefSeq NP_064412 348 lysophosphatidic acid receptor 2

Identical Sequences to LMP002445 proteins

Reference Database Accession Length Protein Name
GI:40254539 DBBJ BAE26107.1 348 unnamed protein product [Mus musculus]
GI:40254539 GenBank AAH60131.1 348 Lpar2 protein [Mus musculus]
GI:40254539 GenBank AAH64676.1 348 Lysophosphatidic acid receptor 2 [Mus musculus]
GI:40254539 GenBank EDL28755.1 348 endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor 4 [Mus musculus]

Related Sequences to LMP002445 proteins

Reference Database Accession Length Protein Name
GI:40254539 GenBank ERE91175.1 348 lysophosphatidic acid receptor [Cricetulus griseus]
GI:40254539 RefSeq XP_003499110.1 348 PREDICTED: lysophosphatidic acid receptor 2 [Cricetulus griseus]
GI:40254539 RefSeq XP_005086214.1 348 PREDICTED: lysophosphatidic acid receptor 2 [Mesocricetus auratus]
GI:40254539 RefSeq XP_005370572.1 349 PREDICTED: lysophosphatidic acid receptor 2 [Microtus ochrogaster]
GI:40254539 RefSeq XP_006995549.1 348 PREDICTED: lysophosphatidic acid receptor 2 [Peromyscus maniculatus bairdii]
GI:40254539 RefSeq XP_007617487.1 348 PREDICTED: lysophosphatidic acid receptor 2 [Cricetulus griseus]