Gene/Proteome Database (LMPD)
Proteins
lysophosphatidic acid receptor 2 | |
---|---|
Refseq ID | NP_064412 |
Protein GI | 40254539 |
UniProt ID | Q6P290 |
mRNA ID | NM_020028 |
Length | 348 |
RefSeq Status | VALIDATED |
MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYLLGNLAAADLFAGMAYLFLMFHTGPRTARLSIKGWFLRQGLLDTSLTASVATLLAIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVPLFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTVVIILGAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMRRTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL |
Gene Information
Entrez Gene ID
Gene Name
lysophosphatidic acid receptor 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009986 | IEA:Ensembl | C | cell surface |
GO:0030139 | IEA:Ensembl | C | endocytic vesicle |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0030165 | IPI:MGI | F | PDZ domain binding |
GO:0070915 | IEA:InterPro | F | lysophosphatidic acid receptor activity |
GO:0007186 | IDA:MGI | P | G-protein coupled receptor signaling pathway |
GO:0000187 | IDA:MGI | P | activation of MAPK activity |
GO:0043410 | IDA:MGI | P | positive regulation of MAPK cascade |
GO:0035025 | IDA:MGI | P | positive regulation of Rho protein signal transduction |
Domain Information
UniProt Annotations
Entry Information
Gene Name
lysophosphatidic acid receptor 2
Protein Entry
Q6P290_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP002445 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
40254539 | RefSeq | NP_064412 | 348 | lysophosphatidic acid receptor 2 |
Identical Sequences to LMP002445 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:40254539 | DBBJ | BAE26107.1 | 348 | unnamed protein product [Mus musculus] |
GI:40254539 | GenBank | AAH60131.1 | 348 | Lpar2 protein [Mus musculus] |
GI:40254539 | GenBank | AAH64676.1 | 348 | Lysophosphatidic acid receptor 2 [Mus musculus] |
GI:40254539 | GenBank | EDL28755.1 | 348 | endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor 4 [Mus musculus] |
Related Sequences to LMP002445 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:40254539 | GenBank | ERE91175.1 | 348 | lysophosphatidic acid receptor [Cricetulus griseus] |
GI:40254539 | RefSeq | XP_003499110.1 | 348 | PREDICTED: lysophosphatidic acid receptor 2 [Cricetulus griseus] |
GI:40254539 | RefSeq | XP_005086214.1 | 348 | PREDICTED: lysophosphatidic acid receptor 2 [Mesocricetus auratus] |
GI:40254539 | RefSeq | XP_005370572.1 | 349 | PREDICTED: lysophosphatidic acid receptor 2 [Microtus ochrogaster] |
GI:40254539 | RefSeq | XP_006995549.1 | 348 | PREDICTED: lysophosphatidic acid receptor 2 [Peromyscus maniculatus bairdii] |
GI:40254539 | RefSeq | XP_007617487.1 | 348 | PREDICTED: lysophosphatidic acid receptor 2 [Cricetulus griseus] |