Gene/Proteome Database (LMPD)

LMPD ID
LMP002473
Gene ID
56351
Species
Mus musculus (Mouse)
Gene Name
prostaglandin E synthase 3 (cytosolic)
Gene Symbol
Ptges3
Synonyms
5730442A20Rik; Ptges; Tebp; cPGES; p23; sid3177
Alternate Names
prostaglandin E synthase 3; sid 3177; p23 cochaperone; hsp90 co-chaperone; telomerase-binding protein p23; telomerase binding protein, p23; progesterone receptor complex p23; cytosolic prostaglandin E2 synthase
Chromosome
10
Map Location
10 D3|10
EC Number
5.3.99.3

Proteins

prostaglandin E synthase 3
Refseq ID NP_062740
Protein GI 9790017
UniProt ID Q9R0Q7
mRNA ID NM_019766
Length 160
RefSeq Status PROVISIONAL
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Gene Information

Entrez Gene ID
56351
Gene Name
prostaglandin E synthase 3 (cytosolic)
Gene Symbol
Ptges3
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005697 IEA:Ensembl C telomerase holoenzyme complex
GO:0050220 ISS:UniProtKB F prostaglandin-E synthase activity
GO:0003720 IEA:Ensembl F telomerase activity
GO:0051082 ISS:UniProtKB F unfolded protein binding
GO:0008283 IMP:MGI P cell proliferation
GO:0070389 IEA:Ensembl P chaperone cofactor-dependent protein refolding
GO:0042921 IMP:MGI P glucocorticoid receptor signaling pathway
GO:0005978 IMP:MGI P glycogen biosynthetic process
GO:0060430 IMP:MGI P lung saccule development
GO:0001516 ISS:UniProtKB P prostaglandin biosynthetic process
GO:0043588 IMP:MGI P skin development

KEGG Pathway Links

KEGG Pathway ID Description
mmu00590 Arachidonic acid metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3DJ-35583 biosynthesis of prostaglandins

REACTOME Pathway Links

REACTOME Pathway ID Description
5894134 Attenuation phase
5894133 HSF1 activation

Domain Information

InterPro Annotations

Accession Description
IPR007052 CS domain
IPR008978 HSP20-like chaperone

UniProt Annotations

Entry Information

Gene Name
prostaglandin E synthase 3 (cytosolic)
Protein Entry
TEBP_MOUSE
UniProt ID
Q9R0Q7
Species
Mouse

Comments

Comment Type Description
Catalytic Activity (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15- dihydroxy-9-oxoprosta-5,13-dienoate. {ECO:0000250|UniProtKB:Q15185}.
Function Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway. {ECO:0000250|UniProtKB:Q15185}.
Pathway Lipid metabolism; prostaglandin biosynthesis. {ECO:0000250|UniProtKB:Q15185}.
Similarity Belongs to the p23/wos2 family. {ECO:0000305}.
Similarity Contains 1 CS domain. {ECO:0000255|PROSITE- ProRule:PRU00547}.
Subcellular Location Cytoplasm {ECO:0000250|UniProtKB:Q3ZBF7}.
Subunit Binds to the progesterone receptor. Interacts with TERT; the interaction, together with HSP90AA1, is required for correct assembly and stabilization of the telomerase holoenzyme complex. Interacts (via PXLE motif) with EGLN1/PHD2, recruiting EGLN1/PHD2 to the HSP90 pathway to facilitate HIF alpha proteins hydroxylation. {ECO:0000250|UniProtKB:Q15185}.
Tissue Specificity Expressed in testis, kidney, bladder and ovary. {ECO:0000269|PubMed:14563409}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002473 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
9790017 RefSeq NP_062740 160 prostaglandin E synthase 3

Identical Sequences to LMP002473 proteins

Reference Database Accession Length Protein Name
GI:9790017 GenBank AAI66579.1 160 Ptges3 protein [Rattus norvegicus]
GI:9790017 RefSeq NP_001124461.1 160 prostaglandin E synthase 3 [Rattus norvegicus]
GI:9790017 RefSeq XP_005079789.1 160 PREDICTED: prostaglandin E synthase 3 isoform X1 [Mesocricetus auratus]
GI:9790017 RefSeq XP_005371265.1 160 PREDICTED: prostaglandin E synthase 3 [Microtus ochrogaster]
GI:9790017 RefSeq XP_006544122.1 160 PREDICTED: prostaglandin E synthase 3-like [Mus musculus]
GI:9790017 RefSeq XP_008826610.1 160 PREDICTED: prostaglandin E synthase 3 [Nannospalax galili]

Related Sequences to LMP002473 proteins

Reference Database Accession Length Protein Name
GI:9790017 DBBJ BAB25906.1 160 unnamed protein product [Mus musculus]
GI:9790017 GenBank AAP34198.1 160 cytosolic PGE synthase [Mus musculus]
GI:9790017 RefSeq XP_003945448.2 208 PREDICTED: prostaglandin E synthase 3-like [Mus musculus]
GI:9790017 RefSeq XP_006987441.1 201 PREDICTED: prostaglandin E synthase 3 [Peromyscus maniculatus bairdii]
GI:9790017 RefSeq XP_007644844.1 168 PREDICTED: prostaglandin E synthase 3 isoform X1 [Cricetulus griseus]
GI:9790017 RefSeq XP_007627869.1 163 PREDICTED: prostaglandin E synthase 3 isoform X2 [Cricetulus griseus]