Gene/Proteome Database (LMPD)

LMPD ID
LMP002478
Gene ID
14745
Species
Mus musculus (Mouse)
Gene Name
lysophosphatidic acid receptor 1
Gene Symbol
Lpar1
Synonyms
AI326300; Edg2; Gpcr26; Kdt2; lpA1; vzg-1
Alternate Names
lysophosphatidic acid receptor 1; rec1.3; LPA receptor 1; G-protein coupled receptor 26; lysophosphatidic acid receptor Edg-2; endothelial differentiation lysophosphatidic acid G-protein-coupled receptor 2
Chromosome
4
Map Location
4 B3|4 32.2 cM

Proteins

lysophosphatidic acid receptor 1 isoform 1
Refseq ID NP_034466
Protein GI 171543831
UniProt ID P61793
mRNA ID NM_010336
Length 364
RefSeq Status VALIDATED
MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSNDHSVV
lysophosphatidic acid receptor 1 isoform 1
Refseq ID NP_766577
Protein GI 171543833
UniProt ID P61793
mRNA ID NM_172989
Length 364
RefSeq Status VALIDATED
Protein sequence is identical to GI:171543831 (mRNA isoform)
lysophosphatidic acid receptor 1 isoform 2
Refseq ID NP_001277415
Protein GI 594191040
UniProt ID P61793
mRNA ID NM_001290486
Length 346
RefSeq Status VALIDATED
MNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSNDHSVV

Gene Information

Entrez Gene ID
14745
Gene Name
lysophosphatidic acid receptor 1
Gene Symbol
Lpar1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009986 ISS:UniProtKB C cell surface
GO:0043198 IEA:Ensembl C dendritic shaft
GO:0043197 IEA:Ensembl C dendritic spine
GO:0030139 IEA:Ensembl C endocytic vesicle
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0030165 IPI:MGI F PDZ domain binding
GO:0070915 IEA:InterPro F lysophosphatidic acid receptor activity
GO:0005543 IEA:Ensembl F phospholipid binding
GO:0007186 IDA:MGI P G-protein coupled receptor signaling pathway
GO:0000187 IDA:MGI P activation of MAPK activity
GO:0032060 IGI:MGI P bleb assembly
GO:0071453 IEA:Ensembl P cellular response to oxygen levels
GO:0042552 IEA:Ensembl P myelination
GO:0010977 IEA:Ensembl P negative regulation of neuron projection development
GO:0043123 IEA:Ensembl P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043410 IDA:MGI P positive regulation of MAPK cascade
GO:0035025 IDA:MGI P positive regulation of Rho protein signal transduction
GO:0043065 IEA:Ensembl P positive regulation of apoptotic process
GO:0051482 IEA:Ensembl P positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
GO:0060999 IEA:Ensembl P positive regulation of dendritic spine development
GO:0071673 IEA:Ensembl P positive regulation of smooth muscle cell chemotaxis

KEGG Pathway Links

KEGG Pathway ID Description
mmu04540 Gap junction
mmu04151 PI3K-Akt signaling pathway
mmu04015 Rap1 signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR004065 Lysophosphatidic acid receptor
IPR002277 Lysophosphatidic acid receptor EDG-2

UniProt Annotations

Entry Information

Gene Name
lysophosphatidic acid receptor 1
Protein Entry
LPAR1_MOUSE
UniProt ID
P61793
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P61793-1, Q61130-1; Sequence=Displayed; Name=2; IsoId=P61793-2, Q61130-2; Sequence=VSP_001986;
Function Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Stimulates phospholipase C (PLC) activity in a manner that is dependent on RALA activation (By similarity). {ECO:0000250}.
Interaction Q9NZN5:ARHGEF12 (xeno); NbExp=3; IntAct=EBI-7512335, EBI-821440;
Similarity Belongs to the G-protein coupled receptor 1 family. {ECO:0000255|PROSITE-ProRule:PRU00521}.
Subcellular Location Cell surface {ECO:0000250}. Cell membrane; Multi-pass membrane protein. Note=Prior to LPA treatment found predominantly at the cell surface but in the presence of LPA co- localizes with RALA in the endocytic vesicles. {ECO:0000250}.
Subunit Interacts with RALA and ADRBK1. {ECO:0000250}.
Tissue Specificity Expressed within the embryonic cerebral cortex, where it is enriched in the ventricular zone. In the adult brain, also expressed in oligodendrocytes, as well as Schwann cells of the peripheral nervous system. Expressed in many other tissues, including testes, lung, heart, intestine, spleen, kidney, thymus, and stomach. No expression in liver.

Identical and Related Proteins

Unique RefSeq proteins for LMP002478 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
171543831 RefSeq NP_034466 364 lysophosphatidic acid receptor 1 isoform 1
594191040 RefSeq NP_001277415 346 lysophosphatidic acid receptor 1 isoform 2

Identical Sequences to LMP002478 proteins

Reference Database Accession Length Protein Name
GI:171543831 RefSeq NP_766577.1 364 lysophosphatidic acid receptor 1 isoform 1 [Mus musculus]
GI:171543831 RefSeq XP_006238257.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]
GI:171543831 RefSeq XP_006238259.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]
GI:171543831 RefSeq XP_006238262.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]
GI:171543831 RefSeq XP_006238263.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]
GI:171543831 RefSeq XP_008761954.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]

Related Sequences to LMP002478 proteins

Reference Database Accession Length Protein Name
GI:171543831 EMBL CAG29888.1 364 unnamed protein product [Mus musculus]
GI:171543831 GenBank AAC34301.1 364 lysophosphatidic acid receptor [Mus musculus]
GI:594191040 GenBank AAH25425.1 364 Lpar1 protein [Mus musculus]
GI:171543831 GenBank EDL02226.1 391 endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2, isoform CRA_a, partial [Mus musculus]
GI:594191040 GenBank EDL02227.1 364 endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2, isoform CRA_b [Mus musculus]
GI:594191040 GenBank EDL91653.1 364 endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2, isoform CRA_a [Rattus norvegicus]
GI:171543831 RefSeq XP_003507018.1 364 PREDICTED: lysophosphatidic acid receptor 1 [Cricetulus griseus]
GI:171543831 RefSeq XP_007645692.1 364 PREDICTED: lysophosphatidic acid receptor 1 [Cricetulus griseus]
GI:171543831 RefSeq XP_007645693.1 364 PREDICTED: lysophosphatidic acid receptor 1 [Cricetulus griseus]
GI:594191040 RefSeq XP_008761954.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]
GI:594191040 SwissProt P61794.1 364 RecName: Full=Lysophosphatidic acid receptor 1; Short=LPA receptor 1; Short=LPA-1; AltName: Full=Lysophosphatidic acid receptor Edg-2 [Rattus norvegicus]
GI:594191040 SwissProt P61793.1 364 RecName: Full=Lysophosphatidic acid receptor 1; Short=LPA receptor 1; Short=LPA-1; AltName: Full=Lysophosphatidic acid receptor Edg-2; AltName: Full=Rec1.3; AltName: Full=VZG-1 [Mus musculus]