Gene/Proteome Database (LMPD)
LMPD ID
LMP002478
Gene ID
Species
Mus musculus (Mouse)
Gene Name
lysophosphatidic acid receptor 1
Gene Symbol
Synonyms
AI326300; Edg2; Gpcr26; Kdt2; lpA1; vzg-1
Alternate Names
lysophosphatidic acid receptor 1; rec1.3; LPA receptor 1; G-protein coupled receptor 26; lysophosphatidic acid receptor Edg-2; endothelial differentiation lysophosphatidic acid G-protein-coupled receptor 2
Chromosome
4
Map Location
4 B3|4 32.2 cM
Proteins
lysophosphatidic acid receptor 1 isoform 1 | |
---|---|
Refseq ID | NP_034466 |
Protein GI | 171543831 |
UniProt ID | P61793 |
mRNA ID | NM_010336 |
Length | 364 |
RefSeq Status | VALIDATED |
MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSNDHSVV |
lysophosphatidic acid receptor 1 isoform 1 | |
---|---|
Refseq ID | NP_766577 |
Protein GI | 171543833 |
UniProt ID | P61793 |
mRNA ID | NM_172989 |
Length | 364 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:171543831 (mRNA isoform) |
lysophosphatidic acid receptor 1 isoform 2 | |
---|---|
Refseq ID | NP_001277415 |
Protein GI | 594191040 |
UniProt ID | P61793 |
mRNA ID | NM_001290486 |
Length | 346 |
RefSeq Status | VALIDATED |
MNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSNDHSVV |
Gene Information
Entrez Gene ID
Gene Name
lysophosphatidic acid receptor 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009986 | ISS:UniProtKB | C | cell surface |
GO:0043198 | IEA:Ensembl | C | dendritic shaft |
GO:0043197 | IEA:Ensembl | C | dendritic spine |
GO:0030139 | IEA:Ensembl | C | endocytic vesicle |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0070915 | IEA:InterPro | F | lysophosphatidic acid receptor activity |
GO:0030165 | IPI:MGI | F | PDZ domain binding |
GO:0005543 | IEA:Ensembl | F | phospholipid binding |
GO:0000187 | IDA:MGI | P | activation of MAPK activity |
GO:0032060 | IGI:MGI | P | bleb assembly |
GO:0071453 | IEA:Ensembl | P | cellular response to oxygen levels |
GO:0007186 | IDA:MGI | P | G-protein coupled receptor signaling pathway |
GO:0042552 | IEA:Ensembl | P | myelination |
GO:0010977 | IEA:Ensembl | P | negative regulation of neuron projection development |
GO:0043065 | IEA:Ensembl | P | positive regulation of apoptotic process |
GO:0051482 | IEA:Ensembl | P | positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway |
GO:0060999 | IEA:Ensembl | P | positive regulation of dendritic spine development |
GO:0043123 | IEA:Ensembl | P | positive regulation of I-kappaB kinase/NF-kappaB signaling |
GO:0043410 | IDA:MGI | P | positive regulation of MAPK cascade |
GO:0035025 | IDA:MGI | P | positive regulation of Rho protein signal transduction |
GO:0071673 | IEA:Ensembl | P | positive regulation of smooth muscle cell chemotaxis |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
lysophosphatidic acid receptor 1
Protein Entry
LPAR1_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P61793-1, Q61130-1; Sequence=Displayed; Name=2; IsoId=P61793-2, Q61130-2; Sequence=VSP_001986; |
Function | Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Stimulates phospholipase C (PLC) activity in a manner that is dependent on RALA activation (By similarity). {ECO:0000250}. |
Interaction | Q9NZN5:ARHGEF12 (xeno); NbExp=3; IntAct=EBI-7512335, EBI-821440; |
Similarity | Belongs to the G-protein coupled receptor 1 family. {ECO:0000255|PROSITE-ProRule:PRU00521}. |
Subcellular Location | Cell surface {ECO:0000250}. Cell membrane; Multi-pass membrane protein. Note=Prior to LPA treatment found predominantly at the cell surface but in the presence of LPA co- localizes with RALA in the endocytic vesicles. {ECO:0000250}. |
Subunit | Interacts with RALA and ADRBK1. {ECO:0000250}. |
Tissue Specificity | Expressed within the embryonic cerebral cortex, where it is enriched in the ventricular zone. In the adult brain, also expressed in oligodendrocytes, as well as Schwann cells of the peripheral nervous system. Expressed in many other tissues, including testes, lung, heart, intestine, spleen, kidney, thymus, and stomach. No expression in liver. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002478 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
171543831 | RefSeq | NP_034466 | 364 | lysophosphatidic acid receptor 1 isoform 1 |
594191040 | RefSeq | NP_001277415 | 346 | lysophosphatidic acid receptor 1 isoform 2 |
Identical Sequences to LMP002478 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:171543831 | RefSeq | NP_766577.1 | 364 | lysophosphatidic acid receptor 1 isoform 1 [Mus musculus] |
GI:171543831 | RefSeq | XP_006238257.1 | 364 | PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus] |
GI:171543831 | RefSeq | XP_006238259.1 | 364 | PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus] |
GI:171543831 | RefSeq | XP_006238262.1 | 364 | PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus] |
GI:171543831 | RefSeq | XP_006238263.1 | 364 | PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus] |
GI:171543831 | RefSeq | XP_008761954.1 | 364 | PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus] |
Related Sequences to LMP002478 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:171543831 | EMBL | CAG29888.1 | 364 | unnamed protein product [Mus musculus] |
GI:171543831 | GenBank | AAC34301.1 | 364 | lysophosphatidic acid receptor [Mus musculus] |
GI:594191040 | GenBank | AAH25425.1 | 364 | Lpar1 protein [Mus musculus] |
GI:171543831 | GenBank | EDL02226.1 | 391 | endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2, isoform CRA_a, partial [Mus musculus] |
GI:594191040 | GenBank | EDL02227.1 | 364 | endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2, isoform CRA_b [Mus musculus] |
GI:594191040 | GenBank | EDL91653.1 | 364 | endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2, isoform CRA_a [Rattus norvegicus] |
GI:171543831 | RefSeq | XP_003507018.1 | 364 | PREDICTED: lysophosphatidic acid receptor 1 [Cricetulus griseus] |
GI:171543831 | RefSeq | XP_007645692.1 | 364 | PREDICTED: lysophosphatidic acid receptor 1 [Cricetulus griseus] |
GI:171543831 | RefSeq | XP_007645693.1 | 364 | PREDICTED: lysophosphatidic acid receptor 1 [Cricetulus griseus] |
GI:594191040 | RefSeq | XP_008761954.1 | 364 | PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus] |
GI:594191040 | SwissProt | P61794.1 | 364 | RecName: Full=Lysophosphatidic acid receptor 1; Short=LPA receptor 1; Short=LPA-1; AltName: Full=Lysophosphatidic acid receptor Edg-2 [Rattus norvegicus] |
GI:594191040 | SwissProt | P61793.1 | 364 | RecName: Full=Lysophosphatidic acid receptor 1; Short=LPA receptor 1; Short=LPA-1; AltName: Full=Lysophosphatidic acid receptor Edg-2; AltName: Full=Rec1.3; AltName: Full=VZG-1 [Mus musculus] |