Gene/Proteome Database (LMPD)

LMPD ID
LMP002485
Gene ID
11331
Species
Homo sapiens (Human)
Gene Name
prohibitin 2
Gene Symbol
PHB2
Synonyms
BAP; BCAP37; Bap37; PNAS-141; REA; p22
Chromosome
12
Map Location
12p13

Proteins

prohibitin-2 isoform 1
Refseq ID NP_001138303
Protein GI 221307584
UniProt ID Q99623
mRNA ID NM_001144831
Length 299
RefSeq Status VALIDATED
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
prohibitin-2 isoform 3
Refseq ID NP_001254629
Protein GI 390608669
UniProt ID Q99623
mRNA ID NM_001267700
Length 261
RefSeq Status VALIDATED
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Gene Information

Entrez Gene ID
11331
Gene Name
prohibitin 2
Gene Symbol
PHB2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0005743 ISS:UniProtKB C mitochondrial inner membrane
GO:0005739 IDA:UniProt C mitochondrion
GO:0016363 IDA:UniProtKB C nuclear matrix
GO:0005634 ISS:UniProtKB C nucleus
GO:0043234 IDA:UniProtKB C protein complex
GO:0030331 NAS:UniProtKB F estrogen receptor binding
GO:0060749 IEA:Ensembl P mammary gland alveolus development
GO:0060744 IEA:Ensembl P mammary gland branching involved in thelarche
GO:0033147 IEA:Ensembl P negative regulation of intracellular estrogen receptor signaling pathway
GO:0033600 IEA:Ensembl P negative regulation of mammary gland epithelial cell proliferation
GO:0045892 IDA:UniProtKB P negative regulation of transcription, DNA-templated
GO:0060762 IEA:Ensembl P regulation of branching involved in mammary gland duct morphogenesis
GO:0006351 IEA:UniProtKB-KW P transcription, DNA-templated

Domain Information

InterPro Annotations

Accession Description
IPR001107 Band 7 protein
IPR000163 Prohibitin

UniProt Annotations

Entry Information

Gene Name
prohibitin 2
Protein Entry
Q99623_HUMAN
UniProt ID
Q99623
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99623-1; Sequence=Displayed; Name=2; IsoId=Q99623-2; Sequence=VSP_045311;
Developmental Stage Levels of expression in fibroblasts decrease heterogeneously during cellular aging.
Function Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging. {ECO
Induction Expression increases approximately 3-fold upon entry into G1 phase compared to other phases of the cell cycle. Also induced following inhibition of mitochondrial protein synthesis by thiamphenicol.
Interaction P03372:ESR1; NbExp=4; IntAct=EBI-358348, EBI-78473;
Similarity Belongs to the prohibitin family.
Subcellular Location Mitochondrion inner membrane . Cytoplasm {ECO
Subunit Interacts with PHB, ESR1, HDAC1 and HDAC5 (By similarity). Interacts with ZNF703. Interacts with STOML2. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP002485 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
221307584 RefSeq NP_001138303 299 prohibitin-2 isoform 1
390608669 RefSeq NP_001254629 261 prohibitin-2 isoform 3

Identical Sequences to LMP002485 proteins

Reference Database Accession Length Protein Name
GI:221307584 EMBL CEF39417.1 299 unnamed protein product [Homo sapiens]
GI:221307584 GenBank AHD74977.1 299 Sequence 15681 from patent US 8586006
GI:221307584 GenBank AIC50867.1 299 PHB2, partial [synthetic construct]
GI:390608669 RefSeq XP_004052658.1 261 PREDICTED: prohibitin-2 isoform 2 [Gorilla gorilla gorilla]
GI:390608669 RefSeq XP_003273831.2 261 PREDICTED: prohibitin-2 isoform 4 [Nomascus leucogenys]
GI:390608669 RefSeq XP_004643574.1 261 PREDICTED: prohibitin-2 isoform X2 [Octodon degus]
GI:390608669 RefSeq XP_005000699.1 261 PREDICTED: prohibitin-2 isoform X2 [Cavia porcellus]
GI:390608669 RefSeq XP_005378910.1 261 PREDICTED: prohibitin-2 isoform X2 [Chinchilla lanigera]
GI:390608669 RefSeq XP_005570057.1 261 PREDICTED: prohibitin-2 isoform X2 [Macaca fascicularis]
GI:221307584 RefSeq XP_007965638.1 299 PREDICTED: prohibitin-2 [Chlorocebus sabaeus]
GI:221307584 RefSeq XP_008823581.1 299 PREDICTED: prohibitin-2 [Nannospalax galili]
GI:221307584 RefSeq XP_010384185.1 299 PREDICTED: prohibitin-2 [Rhinopithecus roxellana]

Related Sequences to LMP002485 proteins

Reference Database Accession Length Protein Name
GI:221307584 GenBank AAH83705.1 299 Prohibitin 2 [Rattus norvegicus]
GI:221307584 RefSeq NP_001013053.1 299 prohibitin-2 [Rattus norvegicus]
GI:390608669 RefSeq XP_004413990.1 261 PREDICTED: prohibitin-2 isoform 2 [Odobenus rosmarus divergens]
GI:390608669 RefSeq XP_004766688.1 261 PREDICTED: prohibitin-2 isoform X3 [Mustela putorius furo]
GI:221307584 RefSeq XP_004909543.1 299 PREDICTED: prohibitin-2 isoform X1 [Heterocephalus glaber]
GI:390608669 RefSeq XP_004909544.1 261 PREDICTED: prohibitin-2 isoform X2 [Heterocephalus glaber]
GI:221307584 RefSeq XP_004869532.1 299 PREDICTED: prohibitin-2 isoform X1 [Heterocephalus glaber]
GI:390608669 RefSeq XP_004869533.1 261 PREDICTED: prohibitin-2 isoform X2 [Heterocephalus glaber]
GI:221307584 RefSeq XP_005338365.1 299 PREDICTED: prohibitin-2 isoform X1 [Ictidomys tridecemlineatus]
GI:390608669 RefSeq XP_005338366.1 261 PREDICTED: prohibitin-2 isoform X2 [Ictidomys tridecemlineatus]
GI:390608669 RefSeq XP_006210946.1 261 PREDICTED: prohibitin-2 isoform X2 [Vicugna pacos]
GI:221307584 SwissProt Q5XIH7.1 299 RecName: Full=Prohibitin-2; AltName: Full=B-cell receptor-associated protein BAP37; Short=BAP-37 [Rattus norvegicus]