Gene/Proteome Database (LMPD)

LMPD ID
LMP002521
Gene ID
6716
Species
Homo sapiens (Human)
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
SRD5A2
Synonyms
-
Alternate Names
3-oxo-5-alpha-steroid 4-dehydrogenase 2; S5AR 2; SR type 2; 5 alpha-SR2; type II 5-alpha reductase; steroid 5-alpha-reductase 2
Chromosome
2
Map Location
2p23
EC Number
1.3.1.22
Summary
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for SRD5A2

Proteins

3-oxo-5-alpha-steroid 4-dehydrogenase 2
Refseq ID NP_000339
Protein GI 39812447
UniProt ID P31213
mRNA ID NM_000348
Length 254
RefSeq Status REVIEWED
MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF

Gene Information

Entrez Gene ID
6716
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
SRD5A2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003865 IEA:InterPro F 3-oxo-5-alpha-steroid 4-dehydrogenase activity
GO:0047751 IEA:UniProtKB-EC F cholestenone 5-alpha-reductase activity
GO:0009917 IDA:UniProtKB F sterol 5-alpha reductase activity
GO:0006702 TAS:Reactome P androgen biosynthetic process
GO:0008209 IDA:UniProtKB P androgen metabolic process
GO:0030154 IEA:UniProtKB-KW P cell differentiation
GO:0007267 TAS:UniProtKB P cell-cell signaling
GO:0008584 IMP:UniProtKB P male gonad development
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0008202 TAS:Reactome P steroid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa05215 Prostate cancer
hsa00140 Steroid hormone biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY66-378 androgen biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_11059 Androgen biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR016636 3-oxo-5-alpha-steroid 4-dehydrogenase
IPR001104 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

UniProt Annotations

Entry Information

Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Protein Entry
S5A2_HUMAN
UniProt ID
P31213
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties pH dependence: Optimally active at acidic pHs.;
Catalytic Activity A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH.
Disease Pseudovaginal perineoscrotal hypospadias (PPSH) [MIM
Function Converts testosterone (T) into 5-alpha- dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Polymorphism Individuals with Thr-49 have an increased risk of prostate cancer. The enzyme with Thr-49 has a higher in vitro V(max) than the Ala-49 enzyme.
Similarity Belongs to the steroid 5-alpha reductase family.
Subcellular Location Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Tissue Specificity Expressed in high levels in the prostate and many other androgen-sensitive tissues.
Web Resource Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/srd5a2/";
Web Resource Name=Wikipedia; Note=5-alpha reductase entry; URL="http://en.wikipedia.org/wiki/5_alpha_reductase";

Identical and Related Proteins

Unique RefSeq proteins for LMP002521 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
39812447 RefSeq NP_000339 254 3-oxo-5-alpha-steroid 4-dehydrogenase 2

Identical Sequences to LMP002521 proteins

Reference Database Accession Length Protein Name
GI:39812447 GenBank ABQ59050.1 254 SRD5A2 protein [Homo sapiens]
GI:39812447 GenBank ACE87820.1 254 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) protein [synthetic construct]
GI:39812447 GenBank ACT64378.1 254 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) protein, partial [synthetic construct]
GI:39812447 GenBank ADR82875.1 254 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2), partial [synthetic construct]
GI:39812447 GenBank AHE01385.1 254 Sequence 56301 from patent US 8586006
GI:39812447 GenBank AIC49782.1 254 SRD5A2, partial [synthetic construct]

Related Sequences to LMP002521 proteins

Reference Database Accession Length Protein Name
GI:39812447 DBBJ BAG38184.1 254 unnamed protein product [Homo sapiens]
GI:39812447 GenBank AAA60586.1 254 steroid 5-alpha-reductase 2 [Homo sapiens]
GI:39812447 GenBank AAA71249.1 254 Sequence 6 from patent US 5422262
GI:39812447 GenBank AAW56942.1 254 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [Homo sapiens]
GI:39812447 pat US 254 Sequence 6 from patent US 5679521
GI:39812447 SwissProt P31213.1 254 RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 2; AltName: Full=5 alpha-SR2; AltName: Full=SR type 2; AltName: Full=Steroid 5-alpha-reductase 2; Short=S5AR 2; AltName: Full=Type II 5-alpha reductase [Homo sapiens]