Gene/Proteome Database (LMPD)
LMPD ID
LMP002546
Gene ID
Species
Mus musculus (Mouse)
Gene Name
farnesyl diphosphate farnesyl transferase 1
Gene Symbol
Synonyms
SQS; SS
Alternate Names
squalene synthase; squalene synthetase; FPP:FPP farnesyltransferase; farnesyl-diphosphate farnesyltransferase
Chromosome
14
Map Location
14 D1|14 33.24 cM
EC Number
2.5.1.21
Proteins
squalene synthase | |
---|---|
Refseq ID | NP_034321 |
Protein GI | 34328173 |
UniProt ID | P53798 |
mRNA ID | NM_010191 |
Length | 416 |
RefSeq Status | PROVISIONAL |
MEFVKCLGHPEEFYNLLRFRMGGRRNFIPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGDIRHAICVFYLVLRALDTVEDDMSISVEKKIPLLCNFHTFLYDPEWRFTESKEKDRQVLEDFPTISLEFRNLAEKYQTVIDDICHRMGCGMAEFVDKDVTSKQDWDKYCHYVAGLVGIGLSRLFSASEFEDPIVGEDIECANSMGLFLQKTNIIRDYLEDQQEGRKFWPQEVWGRYIKKLEDFAKPENVDVAVQCLNELITNTLQHIPDVLTYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIYQYIEEIYHRIPNSDPSSSKTKQVISKIRTQNLPNCQLISRSHYSPIYLSFIMLLAALSWQYLSTLSQVTEDYVQREH |
Gene Information
Entrez Gene ID
Gene Name
farnesyl diphosphate farnesyl transferase 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0004310 | IEA:UniProtKB-EC | F | farnesyl-diphosphate farnesyltransferase activity |
GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
GO:0051996 | IEA:UniProtKB-EC | F | squalene synthase activity |
GO:0006695 | IEA:UniProtKB-KW | P | cholesterol biosynthetic process |
GO:0045338 | IEA:Ensembl | P | farnesyl diphosphate metabolic process |
GO:0008299 | IEA:UniProtKB-KW | P | isoprenoid biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu00100 | Steroid biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
farnesyl diphosphate farnesyl transferase 1
Protein Entry
FDFT_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 2 farnesyl diphosphate + NAD(P)H = squalene + 2 diphosphate + NAD(P)(+). |
Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; |
Function | Critical branch point enzyme of isoprenoid biosynthesis that is thought to regulate the flux of isoprene intermediates through the sterol pathway. |
Pathway | Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 1/3. |
Similarity | Belongs to the phytoene/squalene synthase family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002546 (as displayed in Record Overview)
Identical Sequences to LMP002546 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:34328173 | DBBJ | BAE40489.1 | 416 | unnamed protein product [Mus musculus] |
GI:34328173 | GenBank | EDL36069.1 | 416 | farnesyl diphosphate farnesyl transferase 1 [Mus musculus] |
GI:34328173 | GenBank | AAI38302.1 | 416 | Farnesyl diphosphate farnesyl transferase 1 [Mus musculus] |
GI:34328173 | GenBank | AAI38303.1 | 416 | Farnesyl diphosphate farnesyl transferase 1 [Mus musculus] |
GI:34328173 | RefSeq | XP_006518609.1 | 416 | PREDICTED: squalene synthase isoform X1 [Mus musculus] |
GI:34328173 | SwissProt | P53798.2 | 416 | RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate farnesyltransferase [Mus musculus] |
Related Sequences to LMP002546 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:34328173 | DBBJ | BAA06102.1 | 416 | squalene synthase [Mus musculus] |
GI:34328173 | DBBJ | BAE36836.1 | 416 | unnamed protein product [Mus musculus] |
GI:34328173 | GenBank | AAH81810.1 | 416 | Farnesyl diphosphate farnesyl transferase 1 [Rattus norvegicus] |
GI:34328173 | GenBank | EDL85317.1 | 416 | farnesyl diphosphate farnesyl transferase 1 [Rattus norvegicus] |
GI:34328173 | PRF | - | 416 | squalene synthase [Mus musculus] |
GI:34328173 | SwissProt | Q02769.1 | 416 | RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate farnesyltransferase [Rattus norvegicus] |