Gene/Proteome Database (LMPD)
Proteins
| protein TMEPAI | |
|---|---|
| Refseq ID | NP_075371 |
| Protein GI | 119508428 |
| UniProt ID | A2APF4 |
| mRNA ID | NM_022995 |
| Length | 274 |
| RefSeq Status | VALIDATED |
| MGVNGTAAAAAGQPNVSCACNCQRSLFPSMEITELEFVQIVVIVVVMMVMVVMITCLLSHYKLSARSFISRHSQARRRDDGLSSEGCLWPSESTVSGGMPEPQVYAPPRPTDRLAVPPFIQRSRFQPTYPYLQHEIALPPTISLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLIDSTMLGGPCPPSSNSGISATCYSSGGRMEGPPPTYSEVIGHYPGSSFQHQQSNGPSSLLEGTRLHHSHIAPLENKEKEKQKGHPL | |
Gene Information
Entrez Gene ID
Gene Name
prostate transmembrane protein, androgen induced 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | ISS:UniProtKB | C | Golgi membrane |
| GO:0031901 | ISS:UniProtKB | C | early endosome membrane |
| GO:0010008 | ISS:UniProtKB | C | endosome membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0010991 | ISS:UniProtKB | P | negative regulation of SMAD protein complex assembly |
| GO:0060394 | IDA:UniProtKB | P | negative regulation of pathway-restricted SMAD protein phosphorylation |
| GO:0030512 | IDA:UniProtKB | P | negative regulation of transforming growth factor beta receptor signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5892763 | Disease |
| 5893348 | Downregulation of TGF-beta receptor signaling |
| 5893328 | Loss of Function of SMAD2/3 in Cancer |
| 5893331 | Loss of Function of SMAD4 in Cancer |
| 5893337 | Loss of Function of TGFBR1 in Cancer |
| 5893334 | Loss of Function of TGFBR2 in Cancer |
| 5893332 | SMAD2/3 MH2 Domain Mutants in Cancer |
| 5893327 | SMAD2/3 Phosphorylation Motif Mutants in Cancer |
| 5893330 | SMAD4 MH2 Domain Mutants in Cancer |
| 5892891 | Signal Transduction |
| 5893326 | Signaling by TGF-beta Receptor Complex |
| 5893329 | Signaling by TGF-beta Receptor Complex in Cancer |
| 5893325 | TGF-beta receptor signaling activates SMADs |
| 5893336 | TGFBR1 KD Mutants in Cancer |
| 5893338 | TGFBR1 LBD Mutants in Cancer |
| 5893335 | TGFBR2 Kinase Domain Mutants in Cancer |
| 5893333 | TGFBR2 MSI Frameshift Mutants in Cancer |
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
prostate transmembrane protein, androgen induced 1
Protein Entry
A2APF4_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Domain | The SMAD interaction motif is required for interaction with SMAD2 and SMAD3 and the negative regulation of TGF-beta signaling. {ECO:0000250}. |
| Domain | The WW-binding motifs mediate interaction with NEDD4. {ECO:0000269|PubMed:11042109}. |
| Function | Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYVE9/SARA recruits the intracellular signal transducer and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then form a heteromeric complex with SMAD4 that translocates to the nucleus to regulate transcription. Through interaction with SMAD2 and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent propagation of the intracellular signal (PubMed:20129061). Also involved in down-regulation of the androgen receptor (AR), enhancing ubiquitination and proteasome-mediated degradation of AR, probably by recruiting NEDD4. {ECO:0000269|PubMed:20129061}. |
| Interaction | P46935:Nedd4; NbExp=5; IntAct=EBI-6304097, EBI-773516; |
| Similarity | Belongs to the PMEPA1 family. {ECO:0000305}. |
| Subcellular Location | Early endosome membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. Golgi apparatus membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. |
| Subunit | Interacts with AR. Interacts with LDLRAD4. Interacts (via the SMAD interaction motif) with SMAD2 and SMAD3 (By similarity). Interacts with NEDD4 (via WW-binding motifs). {ECO:0000250, ECO:0000269|PubMed:11042109}. |
| Tissue Specificity | Expressed in brain, heart, kidney, bladder, ovary and adrenal gland. {ECO:0000269|PubMed:24627487}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002590 (as displayed in Record Overview)
Identical Sequences to LMP002590 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:119508428 | EMBL | CAD29011.1 | 274 | unnamed protein product [Mus musculus] |
| GI:119508428 | GenBank | AAI60278.1 | 274 | Prostate transmembrane protein, androgen induced 1 [synthetic construct] |
Related Sequences to LMP002590 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:119508428 | GenBank | AAH69890.1 | 274 | Pmepa1 protein, partial [Mus musculus] |
| GI:119508428 | GenBank | AAH36995.1 | 289 | Pmepa1 protein, partial [Mus musculus] |
| GI:119508428 | RefSeq | XP_005074530.1 | 275 | PREDICTED: transmembrane prostate androgen-induced protein [Mesocricetus auratus] |
| GI:119508428 | RefSeq | XP_005362858.1 | 276 | PREDICTED: transmembrane prostate androgen-induced protein [Microtus ochrogaster] |
| GI:119508428 | RefSeq | XP_006235751.1 | 277 | PREDICTED: transmembrane prostate androgen-induced protein isoform X1 [Rattus norvegicus] |
| GI:119508428 | RefSeq | XP_006500054.1 | 312 | PREDICTED: transmembrane prostate androgen-induced protein isoform X2 [Mus musculus] |