Gene/Proteome Database (LMPD)
LMPD ID
LMP002606
Gene ID
Species
Homo sapiens (Human)
Gene Name
dual adaptor of phosphotyrosine and 3-phosphoinositides
Gene Symbol
Synonyms
BAM32
Alternate Names
dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; hDAPP1; B-cell adapter molecule of 32 kDa; b lymphocyte adapter protein Bam32
Chromosome
4
Map Location
4q25-q27
Proteins
| dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide | |
|---|---|
| Refseq ID | NP_055210 |
| Protein GI | 158631203 |
| UniProt ID | Q9UN19 |
| mRNA ID | NM_014395 |
| Length | 280 |
| RefSeq Status | VALIDATED |
| MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK | |
Gene Information
Entrez Gene ID
Gene Name
dual adaptor of phosphotyrosine and 3-phosphoinositides
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005886 | IDA:UniProtKB | C | plasma membrane |
| GO:0005547 | IDA:UniProtKB | F | phosphatidylinositol-3,4,5-trisphosphate binding |
| GO:0043325 | IDA:UniProtKB | F | phosphatidylinositol-3,4-bisphosphate binding |
| GO:0005543 | NAS:UniProtKB | F | phospholipid binding |
| GO:0006470 | NAS:UniProtKB | P | protein dephosphorylation |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04662 | B cell receptor signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_118700 | Antigen activates B Cell Receptor (BCR) leading to generation of second messengers |
| REACT_118773 | Signaling by the B Cell Receptor (BCR) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
dual adaptor of phosphotyrosine and 3-phosphoinositides
Protein Entry
DAPP1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=hBam1; IsoId=Q9UN19-1; Sequence=Displayed; Name=2; Synonyms=hBam2; IsoId=Q9UN19-2; Sequence=VSP_010699; |
| Function | May act as a B-cell-associated adapter that regulates B- cell antigen receptor (BCR)-signaling downstream of PI3K. |
| Induction | Upon B-cell activation. |
| Ptm | Phosphorylated on tyrosine residues. |
| Similarity | Contains 1 PH domain. {ECO |
| Similarity | Contains 1 SH2 domain. {ECO |
| Subcellular Location | Cytoplasm . Membrane ; Peripheral membrane protein . Note=Membrane-associated after cell stimulation leading to its translocation. |
| Subunit | Interacts with PtdIns(3,4,5)P3 and PLCG2. In vitro, interacts with PtdIns(3,4)P2. {ECO |
| Tissue Specificity | Highly expressed in placenta and lung, followed by brain, heart, kidney, liver, pancreas and skeletal muscle. Expressed by B-lymphocytes, but not T-lymphocytes or nonhematopoietic cells. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002606 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 158631203 | RefSeq | NP_055210 | 280 | dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide |
Identical Sequences to LMP002606 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:158631203 | DBBJ | BAI47075.1 | 280 | dual adaptor of phosphotyrosine and 3-phosphoinositides, partial [synthetic construct] |
| GI:158631203 | GenBank | EAX06108.1 | 280 | dual adaptor of phosphotyrosine and 3-phosphoinositides, isoform CRA_a [Homo sapiens] |
| GI:158631203 | GenBank | ABM84502.1 | 280 | dual adaptor of phosphotyrosine and 3-phosphoinositides [synthetic construct] |
| GI:158631203 | GenBank | ABM85591.1 | 280 | dual adaptor of phosphotyrosine and 3-phosphoinositides, partial [synthetic construct] |
| GI:158631203 | RefSeq | XP_003829986.1 | 280 | PREDICTED: dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide isoform X1 [Pan paniscus] |
| GI:158631203 | RefSeq | XP_004040230.1 | 280 | PREDICTED: dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide isoform 1 [Gorilla gorilla gorilla] |
Related Sequences to LMP002606 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:158631203 | GenBank | EHH53862.1 | 280 | hypothetical protein EGM_14570 [Macaca fascicularis] |
| GI:158631203 | GenBank | JAB06681.1 | 280 | dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide [Callithrix jacchus] |
| GI:158631203 | RefSeq | XP_002745602.1 | 280 | PREDICTED: dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide [Callithrix jacchus] |
| GI:158631203 | RefSeq | XP_002815045.1 | 280 | PREDICTED: dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide isoform X2 [Pongo abelii] |
| GI:158631203 | RefSeq | XP_007997570.1 | 280 | PREDICTED: dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide [Chlorocebus sabaeus] |
| GI:158631203 | RefSeq | XP_010369940.1 | 280 | PREDICTED: dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide [Rhinopithecus roxellana] |