Gene/Proteome Database (LMPD)
LMPD ID
LMP002626
Gene ID
Species
Homo sapiens (Human)
Gene Name
apolipoprotein D
Gene Symbol
Synonyms
-
Alternate Names
apolipoprotein D; apo-D
Chromosome
3
Map Location
3q29
Summary
This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism. [provided by RefSeq, Aug 2008]
Orthologs
Proteins
| apolipoprotein D precursor | |
|---|---|
| Refseq ID | NP_001638 |
| Protein GI | 4502163 |
| UniProt ID | P05090 |
| mRNA ID | NM_001647 |
| Length | 189 |
| RefSeq Status | REVIEWED |
| MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS | |
| sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1991 peptide sequence: MVMLLLLLSALAGLFGAAEG | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0022626 | ISS:UniProtKB | C | cytosolic ribosome |
| GO:0030425 | ISS:UniProtKB | C | dendrite |
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0005576 | NAS:UniProtKB | C | extracellular region |
| GO:0005615 | IDA:UniProtKB | C | extracellular space |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0043025 | ISS:UniProtKB | C | neuronal cell body |
| GO:0048471 | IDA:UniProtKB | C | perinuclear region of cytoplasm |
| GO:0015485 | IDA:UniProtKB | F | cholesterol binding |
| GO:0005319 | NAS:UniProtKB | F | lipid transporter activity |
| GO:0007568 | NAS:UniProtKB | P | aging |
| GO:0001525 | NAS:UniProtKB | P | angiogenesis |
| GO:0007420 | ISS:UniProtKB | P | brain development |
| GO:0006006 | IDA:UniProtKB | P | glucose metabolic process |
| GO:0006629 | IDA:UniProtKB | P | lipid metabolic process |
| GO:0006869 | NAS:GOC | P | lipid transport |
| GO:2000405 | IDA:UniProtKB | P | negative regulation of T cell migration |
| GO:1900016 | IDA:UniProtKB | P | negative regulation of cytokine production involved in inflammatory response |
| GO:0051895 | IMP:UniProtKB | P | negative regulation of focal adhesion assembly |
| GO:0060588 | IDA:UniProtKB | P | negative regulation of lipoprotein lipid oxidation |
| GO:0071638 | IDA:UniProtKB | P | negative regulation of monocyte chemotactic protein-1 production |
| GO:0010642 | IDA:UniProtKB | P | negative regulation of platelet-derived growth factor receptor signaling pathway |
| GO:0042308 | IDA:UniProtKB | P | negative regulation of protein import into nucleus |
| GO:0048662 | IDA:UniProtKB | P | negative regulation of smooth muscle cell proliferation |
| GO:2000098 | IMP:UniProtKB | P | negative regulation of smooth muscle cell-matrix adhesion |
| GO:0014012 | ISS:UniProtKB | P | peripheral nervous system axon regeneration |
| GO:0048678 | ISS:UniProtKB | P | response to axon injury |
| GO:0042493 | ISS:UniProtKB | P | response to drug |
| GO:0000302 | IDA:UniProtKB | P | response to reactive oxygen species |
| GO:0042246 | ISS:UniProtKB | P | tissue regeneration |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | APOD occurs in the macromolecular complex with lecithin- cholesterol acyltransferase. It is probably involved in the transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts. |
| Miscellaneous | APOD is primarily localized in HDL (60-65%), with most of the remainder in VHDL and only trace amounts in VLDL and LDL. |
| Ptm | N-glycosylatd. N-glycan heterogeneity at Asn-65: Hex5HexNAc4 (major) and Hex6HexNAc5 (minor); at Asn-98: Hex5HexNAc4 (minor), dHex1Hex5HexNAc4 (major), dHex1Hex6HexNAc5 (minor) and dHex1Hex7HexNAc6 (minor). {ECO |
| Similarity | Belongs to the calycin superfamily. Lipocalin family. |
| Subcellular Location | Secreted. |
| Subunit | Homodimer. In plasma, also exists as a disulfide-linked heterodimer with APOA2. |
| Tissue Specificity | Expressed in liver, intestine, pancreas, kidney, placenta, adrenal, spleen, fetal brain tissue and tears. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002626 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4502163 | RefSeq | NP_001638 | 189 | apolipoprotein D precursor |
Identical Sequences to LMP002626 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502163 | GenBank | ACM80605.1 | 189 | Sequence 6103 from patent US 6812339 |
| GI:4502163 | GenBank | ACN00274.1 | 189 | Sequence 224 from patent US 7476723 |
| GI:4502163 | GenBank | ADS26268.1 | 189 | Sequence 224 from patent US 7777007 |
| GI:4502163 | GenBank | ADS58649.1 | 189 | Sequence 224 from patent US 7807385 |
| GI:4502163 | GenBank | AHD75033.1 | 189 | Sequence 16312 from patent US 8586006 |
| GI:4502163 | GenBank | AIC48280.1 | 189 | APOD, partial [synthetic construct] |
Related Sequences to LMP002626 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502163 | GenBank | AAX29138.1 | 190 | apolipoprotein D, partial [synthetic construct] |
| GI:4502163 | GenBank | AAX36879.1 | 190 | apolipoprotein D, partial [synthetic construct] |
| GI:4502163 | GenBank | JAA08583.1 | 189 | apolipoprotein D [Pan troglodytes] |
| GI:4502163 | GenBank | JAA22562.1 | 189 | apolipoprotein D [Pan troglodytes] |
| GI:4502163 | GenBank | AGB62526.1 | 225 | Sequence 87 from patent US 8288091 |
| GI:4502163 | RefSeq | XP_003807686.1 | 189 | PREDICTED: apolipoprotein D [Pan paniscus] |