Gene/Proteome Database (LMPD)
LMPD ID
LMP002645
Gene ID
Species
Homo sapiens (Human)
Gene Name
monoglyceride lipase
Gene Symbol
Synonyms
HU-K5; HUK5; MAGL; MGL
Chromosome
3
Map Location
3q21.3
EC Number
3.1.1.23
Summary
This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]
Orthologs
Proteins
| monoglyceride lipase isoform 1 | |
|---|---|
| Refseq ID | NP_009214 |
| Protein GI | 6005786 |
| UniProt ID | Q99685 |
| mRNA ID | NM_007283 |
| Length | 313 |
| RefSeq Status | REVIEWED |
| METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP | |
| monoglyceride lipase isoform 2 | |
|---|---|
| Refseq ID | NP_001003794 |
| Protein GI | 51242953 |
| UniProt ID | Q99685 |
| mRNA ID | NM_001003794 |
| Length | 303 |
| RefSeq Status | REVIEWED |
| MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP | |
| monoglyceride lipase isoform 3 | |
|---|---|
| Refseq ID | NP_001243514 |
| Protein GI | 375268702 |
| UniProt ID | Q99685 |
| mRNA ID | NM_001256585 |
| Length | 283 |
| RefSeq Status | REVIEWED |
| METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0005886 | TAS:Reactome | C | plasma membrane |
| GO:0045202 | IEA:Ensembl | C | synapse |
| GO:0047372 | ISS:UniProtKB | F | acylglycerol lipase activity |
| GO:0008289 | IEA:Ensembl | F | lipid binding |
| GO:0004622 | TAS:ProtInc | F | lysophospholipase activity |
| GO:0042803 | IPI:UniProtKB | F | protein homodimerization activity |
| GO:0036155 | TAS:Reactome | P | acylglycerol acyl-chain remodeling |
| GO:0046464 | ISS:UniProtKB | P | acylglycerol catabolic process |
| GO:0019369 | ISS:UniProtKB | P | arachidonic acid metabolic process |
| GO:0007596 | TAS:Reactome | P | blood coagulation |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0006954 | TAS:ProtInc | P | inflammatory response |
| GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
| GO:0060292 | IEA:Ensembl | P | long term synaptic depression |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0030168 | TAS:Reactome | P | platelet activation |
| GO:2000124 | ISS:UniProtKB | P | regulation of endocannabinoid signaling pathway |
| GO:0050727 | ISS:UniProtKB | P | regulation of inflammatory response |
| GO:0051930 | ISS:UniProtKB | P | regulation of sensory perception of pain |
| GO:0009966 | ISS:UniProtKB | P | regulation of signal transduction |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0019433 | TAS:Reactome | P | triglyceride catabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04723 | Retrograde endocannabinoid signaling |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121122 | Acyl chain remodeling of DAG and TAG |
| REACT_19308 | Arachidonate production from DAG |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99685-1; Sequence=Displayed; Name=2; IsoId=Q99685-2; Sequence=VSP_045138, VSP_045139; |
| Catalytic Activity | Hydrolyzes glycerol monoesters of long-chain fatty acids. |
| Function | Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (By similarity). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth. |
| Miscellaneous | Short-term inhibition causes analgesia, while long- term inhibition causes tolerance to endocannabinoids acting on brain cannabinoid receptor CNR1, and a reduction in brain cannabinoid receptor CNR1 activity. |
| Pathway | Glycerolipid metabolism; triacylglycerol degradation. |
| Sequence Caution | Sequence=AAB39616.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAH00551.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAH06230.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=BAG37910.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=CAG33116.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=EAW79330.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=EAW79331.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; |
| Similarity | Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family. |
| Subunit | Homodimer. {ECO |
| Tissue Specificity | Detected in adipose tissue, lung, liver, kidney, brain and heart. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002645 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6005786 | RefSeq | NP_009214 | 313 | monoglyceride lipase isoform 1 |
| 51242953 | RefSeq | NP_001003794 | 303 | monoglyceride lipase isoform 2 |
| 375268702 | RefSeq | NP_001243514 | 283 | monoglyceride lipase isoform 3 |
Identical Sequences to LMP002645 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:375268702 | DBBJ | BAH14267.1 | 283 | unnamed protein product [Homo sapiens] |
| GI:51242953 | EMBL | CBV35050.1 | 303 | unnamed protein product [Homo sapiens] |
| GI:51242953 | GenBank | AEU57017.1 | 303 | Sequence 1 from patent US 8067220 |
| GI:6005786 | GenBank | JAA13795.1 | 313 | monoglyceride lipase [Pan troglodytes] |
| GI:6005786 | GenBank | JAA22963.1 | 313 | monoglyceride lipase [Pan troglodytes] |
| GI:6005786 | GenBank | JAA37897.1 | 313 | monoglyceride lipase [Pan troglodytes] |
| GI:6005786 | GenBank | AGY13361.1 | 313 | Sequence 106775 from patent US 8541208 |
| GI:51242953 | GenBank | AGY13442.1 | 303 | Sequence 106937 from patent US 8541208 |
| GI:51242953 | GenBank | AHD78543.1 | 303 | Sequence 26541 from patent US 8586006 |
| GI:6005786 | GenBank | AHD78544.1 | 313 | Sequence 26542 from patent US 8586006 |
| GI:6005786 | GenBank | AIC50872.1 | 313 | MGLL, partial [synthetic construct] |
| GI:51242953 | RefSeq | XP_003310034.1 | 303 | PREDICTED: monoglyceride lipase isoform X4 [Pan troglodytes] |
| GI:375268702 | RefSeq | XP_001140395.2 | 283 | PREDICTED: monoglyceride lipase isoform X6 [Pan troglodytes] |
| GI:51242953 | RefSeq | XP_003815295.1 | 303 | PREDICTED: monoglyceride lipase isoform X2 [Pan paniscus] |
| GI:375268702 | RefSeq | XP_003815297.1 | 283 | PREDICTED: monoglyceride lipase isoform X3 [Pan paniscus] |
Related Sequences to LMP002645 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6005786 | DBBJ | BAG52334.1 | 313 | unnamed protein product [Homo sapiens] |
| GI:51242953 | EMBL | CBV34969.1 | 313 | unnamed protein product [Homo sapiens] |
| GI:51242953 | GenBank | ABC13626.1 | 313 | Sequence 18 from patent US 6964849 |
| GI:51242953 | GenBank | ABC13678.1 | 313 | Sequence 81 from patent US 6964849 |
| GI:375268702 | GenBank | ABC13747.1 | 287 | Sequence 322 from patent US 6964849 |
| GI:51242953 | GenBank | ABE19149.1 | 313 | Sequence 18 from patent US 6991901 |
| GI:51242953 | GenBank | ABE19201.1 | 313 | Sequence 81 from patent US 6991901 |
| GI:375268702 | GenBank | ABL57367.1 | 287 | Sequence 322 from patent US 7141549 |
| GI:6005786 | GenBank | AEX17039.1 | 314 | Sequence 2 from patent US 8080400 |
| GI:6005786 | GenBank | AFS91220.1 | 314 | Sequence 2 from patent US 8257698 |
| GI:375268702 | GenBank | AIC50872.1 | 313 | MGLL, partial [synthetic construct] |
| GI:51242953 | GenBank | AIC50872.1 | 313 | MGLL, partial [synthetic construct] |
| GI:6005786 | RefSeq | XP_002813210.1 | 313 | PREDICTED: monoglyceride lipase isoform X1 [Pongo abelii] |
| GI:375268702 | RefSeq | XP_002813212.1 | 283 | PREDICTED: monoglyceride lipase isoform X3 [Pongo abelii] |
| GI:6005786 | RefSeq | XP_004036296.1 | 314 | PREDICTED: monoglyceride lipase isoform 1 [Gorilla gorilla gorilla] |
| GI:375268702 | RefSeq | XP_004036297.1 | 284 | PREDICTED: monoglyceride lipase isoform 2 [Gorilla gorilla gorilla] |
| GI:6005786 | RefSeq | XP_005571844.1 | 313 | PREDICTED: monoglyceride lipase isoform X4 [Macaca fascicularis] |
| GI:375268702 | RefSeq | XP_005571846.1 | 283 | PREDICTED: monoglyceride lipase isoform X6 [Macaca fascicularis] |