Gene/Proteome Database (LMPD)

LMPD ID
LMP002646
Gene ID
14080
Species
Mus musculus (Mouse)
Gene Name
fatty acid binding protein 1, liver
Gene Symbol
Fabp1
Synonyms
Fabpl; L-FABP
Alternate Names
fatty acid-binding protein, liver; fatty acid-binding protein 1; 14 kDa selenium-binding protein; fatty acid binding protein liver; liver-type fatty acid-binding protein
Chromosome
6
Map Location
6 C1|6 32.14 cM

Proteins

fatty acid-binding protein, liver
Refseq ID NP_059095
Protein GI 8393343
UniProt ID P12710
mRNA ID NM_017399
Length 127
RefSeq Status PROVISIONAL
MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI

Gene Information

Entrez Gene ID
14080
Gene Name
fatty acid binding protein 1, liver
Gene Symbol
Fabp1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0045179 IEA:Ensembl C apical cortex
GO:0005737 IDA:MGI C cytoplasm
GO:0005829 IEA:Ensembl C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005634 IDA:MGI C nucleus
GO:0005782 IEA:Ensembl C peroxisomal matrix
GO:0016209 IEA:Ensembl F antioxidant activity
GO:0032052 IEA:Ensembl F bile acid binding
GO:0003682 IDA:MGI F chromatin binding
GO:0008144 IEA:Ensembl F drug binding
GO:0005504 ISO:MGI F fatty acid binding
GO:0005324 IEA:Ensembl F long-chain fatty acid transporter activity
GO:0005543 IEA:Ensembl F phospholipid binding
GO:0070301 IEA:Ensembl P cellular response to hydrogen peroxide
GO:0071456 IEA:Ensembl P cellular response to hypoxia
GO:0050892 IEA:Ensembl P intestinal absorption
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0043154 IEA:Ensembl P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0032000 IEA:Ensembl P positive regulation of fatty acid beta-oxidation
GO:0051345 IEA:Ensembl P positive regulation of hydrolase activity

KEGG Pathway Links

KEGG Pathway ID Description
mmu04975 Fat digestion and absorption
mmu03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5893843 PPARA activates gene expression

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 1, liver
Protein Entry
FABPL_MOUSE
UniProt ID
P12710
Species
Mouse

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. {ECO:0000250}.
Function Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. Also seems to bind selenium.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. {ECO:0000305}.
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP002646 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8393343 RefSeq NP_059095 127 fatty acid-binding protein, liver

Identical Sequences to LMP002646 proteins

Reference Database Accession Length Protein Name
GI:8393343 DBBJ BAE20841.1 127 unnamed protein product [Mus musculus]
GI:8393343 EMBL CAA74989.1 127 fatty acid binding protein L-FABP [Mus musculus]
GI:8393343 GenBank AAH09812.1 127 Fatty acid binding protein 1, liver [Mus musculus]
GI:8393343 GenBank EDK98932.1 127 fatty acid binding protein 1, liver [Mus musculus]
GI:8393343 SwissProt P12710.2 127 RecName: Full=Fatty acid-binding protein, liver; AltName: Full=14 kDa selenium-binding protein; AltName: Full=Fatty acid-binding protein 1; AltName: Full=Liver-type fatty acid-binding protein; Short=L-FABP [Mus musculus]

Related Sequences to LMP002646 proteins

Reference Database Accession Length Protein Name
GI:8393343 EMBL CAA24545.1 127 unnamed protein product [Rattus norvegicus]
GI:8393343 GenBank EDL90984.1 127 fatty acid binding protein 1, liver [Rattus norvegicus]
GI:8393343 PDB 2JU3 127 Chain A, Solution-State Nmr Structures Of Apo-Lfabp (Liver Fatty Acid-Binding Protein)
GI:8393343 PDB 2JU7 127 Chain A, Solution-State Structures Of Oleate-Liganded Lfabp, Protein Only
GI:8393343 PDB 2JU8 127 Chain A, Solution-State Structures Of Oleate-Liganded Lfabp, Major Form Of 1:2 Protein-Ligand Complex
GI:8393343 SwissProt P02692.1 127 RecName: Full=Fatty acid-binding protein, liver; AltName: Full=Fatty acid-binding protein 1; AltName: Full=Liver-type fatty acid-binding protein; Short=L-FABP; AltName: Full=Squalene- and sterol-carrier protein; Short=SCP; AltName: Full=Z-protein; AltName: Full=p14 [Rattus norvegicus]