Gene/Proteome Database (LMPD)
LMPD ID
LMP002702
Gene ID
Species
Homo sapiens (Human)
Gene Name
lysophospholipase II
Gene Symbol
Synonyms
APT-2; DJ886K2.4
Alternate Names
acyl-protein thioesterase 2; LPL-II; lysoPLA II
Chromosome
1
Map Location
1p36.11
EC Number
3.1.2.-
Summary
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| acyl-protein thioesterase 2 | |
|---|---|
| Refseq ID | NP_009191 |
| Protein GI | 9966764 |
| UniProt ID | O95372 |
| mRNA ID | NM_007260 |
| Length | 231 |
| RefSeq Status | REVIEWED |
| MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0016787 | IEA:UniProtKB-KW | F | hydrolase activity |
| GO:0006631 | IEA:UniProtKB-KW | P | fatty acid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-protein + H(2)O = palmitate + protein. |
| Function | May hydrolyze fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has lysophospholipase activity (By similarity). Deacylates GAP43. |
| Sequence Caution | Sequence=AAP97210.1; Type=Frameshift; Positions=5, 164, 179; Evidence= ; |
| Similarity | Belongs to the AB hydrolase superfamily. AB hydrolase 2 family. |
| Subcellular Location | Cytoplasm . |
Identical and Related Proteins
Unique RefSeq proteins for LMP002702 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 9966764 | RefSeq | NP_009191 | 231 | acyl-protein thioesterase 2 |
Identical Sequences to LMP002702 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9966764 | RefSeq | XP_007978260.1 | 231 | PREDICTED: acyl-protein thioesterase 2 [Chlorocebus sabaeus] |
| GI:9966764 | RefSeq | XP_008263910.1 | 231 | PREDICTED: acyl-protein thioesterase 2 [Oryctolagus cuniculus] |
| GI:9966764 | RefSeq | XP_008692835.1 | 231 | PREDICTED: acyl-protein thioesterase 2 [Ursus maritimus] |
| GI:9966764 | RefSeq | XP_008961367.1 | 231 | PREDICTED: acyl-protein thioesterase 2 isoform X2 [Pan paniscus] |
| GI:9966764 | RefSeq | XP_009448865.1 | 231 | PREDICTED: acyl-protein thioesterase 2 isoform X1 [Pan troglodytes] |
| GI:9966764 | RefSeq | XP_010354065.1 | 231 | PREDICTED: acyl-protein thioesterase 2 [Rhinopithecus roxellana] |
Related Sequences to LMP002702 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9966764 | RefSeq | XP_004465472.1 | 342 | PREDICTED: acyl-protein thioesterase 2 isoform 1 [Dasypus novemcinctus] |
| GI:9966764 | RefSeq | XP_004465473.1 | 342 | PREDICTED: acyl-protein thioesterase 2 isoform 2 [Dasypus novemcinctus] |
| GI:9966764 | RefSeq | XP_004465474.1 | 314 | PREDICTED: acyl-protein thioesterase 2 isoform 3 [Dasypus novemcinctus] |
| GI:9966764 | RefSeq | XP_004465475.1 | 281 | PREDICTED: acyl-protein thioesterase 2 isoform 4 [Dasypus novemcinctus] |
| GI:9966764 | RefSeq | XP_004783519.1 | 307 | PREDICTED: acyl-protein thioesterase 2 isoform X5 [Mustela putorius furo] |
| GI:9966764 | RefSeq | XP_001501400.3 | 281 | PREDICTED: acyl-protein thioesterase 2 isoform X1 [Equus caballus] |